KEGG   Paracoccus aminophilus: JCM7686_1061Help
Entry
JCM7686_1061      CDS       T02792                                 

Definition
(GenBank) aldehyde dehydrogenase (NAD+)
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
pami  Paracoccus aminophilus
Pathway
pami00010  Glycolysis / Gluconeogenesis
pami00053  Ascorbate and aldarate metabolism
pami00071  Fatty acid degradation
pami00280  Valine, leucine and isoleucine degradation
pami00310  Lysine degradation
pami00330  Arginine and proline metabolism
pami00340  Histidine metabolism
pami00380  Tryptophan metabolism
pami00410  beta-Alanine metabolism
pami00561  Glycerolipid metabolism
pami00620  Pyruvate metabolism
pami00625  Chloroalkane and chloroalkene degradation
pami00903  Limonene and pinene degradation
pami01100  Metabolic pathways
pami01110  Biosynthesis of secondary metabolites
pami01120  Microbial metabolism in diverse environments
pami01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pami00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    JCM7686_1061
   00053 Ascorbate and aldarate metabolism
    JCM7686_1061
   00620 Pyruvate metabolism
    JCM7686_1061
  09103 Lipid metabolism
   00071 Fatty acid degradation
    JCM7686_1061
   00561 Glycerolipid metabolism
    JCM7686_1061
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    JCM7686_1061
   00310 Lysine degradation
    JCM7686_1061
   00330 Arginine and proline metabolism
    JCM7686_1061
   00340 Histidine metabolism
    JCM7686_1061
   00380 Tryptophan metabolism
    JCM7686_1061
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    JCM7686_1061
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    JCM7686_1061
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    JCM7686_1061
Enzymes [BR:pami01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     JCM7686_1061
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh DUF1487
Motif
Other DBs
NCBI-ProteinID: AGT08170
UniProt: S5XXK7
Position
1040194..1042536
Genome map
AA seq 780 aa AA seqDB search
MPSVSEIMDHLDYGASVEDAAAVRDWLAQHQKFGHFIGGSFTQPGRGFATSDPATGEVLA
HVSQGGDEDVGKAVKAARKAQPAWAALSGHDRARYLYAIARTIQKRERFLAVLETLDNGK
PIRETRDIDVPLVVRHFYHHAGWAELAETEFPGLRPLGVCGQIIPWNFPLLMLAWKVAPA
LAAGNTVVLKPAEYTPLTALAFAEICQHVGLPAGVVNIVTGDGETGAALVRAKTDKIAFT
GSTEVGRAIAHALAGSGRKLTLELGGKSPFVVMEDADLDAAVEGVVDSIWFNQGEVCCAG
SRILVAESVSARFEALLRARMEKLRVGAPLDKSTDVGAIVHPVQKERILKICRDAVAAGA
ELVGGAPLAGCFVAPGYLRGIAPANPGMSEEIFGPIATLSTFRTPDEAADLANNTRYGLA
ASIWSESATVATDMAARIKAGVVWINAANLFDAAAPFGGVKDSGYGREGGRAGMRDYLTG
PEVKAQAESKPAPISTVPEGQTGQRAGIDRTAKLYIGGAQKRPDGGASYLADGALIPLGG
RKDIRNAVEAAHAGRAKWAGLGAHGRAQVLYFLAENLELRRAELTALVGAPEVDVAIRRA
FFYAGFADKFDGATIAAKTGHLVLVQPEAQGVIGITCPNDAPLAGFLSLVLPAIAMGNAV
VAVPSQDHPLAALTLYQIFDTSDLPGGTVNIVTGPRDELAANLASHDDVQAIWHVGATGS
AGLTRVEEAAAVTLKPVWSPTLRDWTAAAQGRDFLRHATRDKTIWLPYGALPAGTGSAAY
NT seq 2343 nt NT seq  +upstreamnt  +downstreamnt
atgccaagcgtgagcgagattatggaccatctggactacggcgcttcggttgaggacgcg
gcggcggtccgcgactggctggcgcaacatcaaaagtttggccatttcatcggcggcagt
ttcacccagccgggccggggctttgcgaccagcgatccggcgaccggcgaggttctcgcc
catgtcagccagggcggcgacgaagatgtcggcaaggcggtcaaggcggcgcgcaaagcc
cagcccgcttgggcggcgctttcgggccacgaccgcgcgcgctatctctacgccatcgcc
cgcaccattcagaagcgcgaacgcttcctcgcggtcctcgaaacgctcgacaacgggaag
ccgatccgcgagacgcgcgacatcgacgtgccgctggtcgtgcgccatttctaccatcac
gccggttgggccgagcttgccgagaccgagttccccggcctgcgcccgcttggcgtctgc
ggccagatcatcccgtggaacttcccgcttctgatgctcgcctggaaggtcgcgccggcg
ctggcggcgggcaataccgtcgttttgaagcctgccgaatatacaccgctgaccgctctg
gccttcgccgagatttgccaacatgtcggcctgcccgcgggcgtcgtcaatatcgtgacc
ggtgatggcgagaccggcgccgcgctggtgcgcgccaagaccgacaagatcgccttcacc
ggctcgaccgaggtcgggcgcgcgattgcccatgccttggcgggcagcgggcgcaagctg
accttggagcttggaggcaaatcgccctttgtcgtcatggaggacgccgatctcgatgcc
gccgtcgaaggcgtggtcgattcgatctggttcaatcagggtgaggtctgctgtgcgggt
tcgcgcattctggtcgcggaaagcgtctcggcccggttcgaggcgctgttgcgcgcccgg
atggagaagctgcgcgtcggcgcgcccttggacaaatcgaccgatgtcggcgcgatcgtc
catcccgtccagaaagagcgcattctgaagatttgtcgcgatgcggtggcggcgggggcg
gagctcgtgggcggcgcgccgcttgcgggctgtttcgtcgcgccgggctatctgcggggt
atcgcgcccgccaatcccgggatgagcgaagagattttcggcccgatcgccacgctctcg
accttccgcaccccggatgaggcggcggatctggccaataacacccgctacgggctggcc
gcgagcatctggtcggaaagcgccacggtcgcgaccgatatggcggcgcggatcaaggcg
ggcgtggtctggatcaatgcggcgaacctctttgacgcggcagcaccctttggcggggtg
aaggacagcggctacgggcgcgagggtgggcgcgccgggatgcgcgattatctgacggga
ccagaggtcaaggcgcaggccgaaagcaaacccgccccgatcagcaccgtgccggagggg
cagacggggcagcgcgcggggatcgaccgcacggcgaagctctatatcggcggcgcgcaa
aagcggcccgatggcggggcgagctatcttgccgatggtgcgctgatccccttgggcggc
cgcaaggacatccgcaatgcggtcgaggccgcccatgcgggacgcgcgaaatgggccggg
ctcggtgcgcatggccgcgcgcaggtgctctatttcctggccgagaaccttgaattgcgc
cgtgccgagctgacggctctggtcggtgcgcccgaggtcgatgtcgcgatccgtcgcgcc
ttcttctatgctggtttcgccgataaattcgacggcgcgacaatcgcggccaagaccggt
catctcgtgctggtccagcccgaggcgcagggcgtgatcggcatcacctgcccgaatgac
gcgcctttggcggggttcctgtcactggtcctgcccgcgattgcgatgggcaatgcggtg
gtcgccgtgccctcgcaggatcatccgctggccgcgctgacgctttaccagatctttgac
acttcggatctgcccggcggcacggtcaatatcgtgaccggcccaagggatgagctcgcg
gccaatctggcgagccatgacgatgtgcaggcgatctggcatgtcggggccaccggatct
gcggggctgacgcgcgtcgaggaagccgcagccgtcacgctgaaaccggtctggtcgccg
acgttgcgagattggacagccgccgcgcaggggcgcgatttcctgcgccatgcgacgcgc
gacaagacgatctggctgccttacggcgccttgcccgcaggcaccggcagcgcggcctat
tag

DBGET integrated database retrieval system