KEGG   Paracoccus aminophilus: JCM7686_1119Help
Entry
JCM7686_1119      CDS       T02792                                 

Definition
(GenBank) 3-ketoacyl-(acyl-carrier-protein) reductase
  KO
K00076  7-alpha-hydroxysteroid dehydrogenase [EC:1.1.1.159]
Organism
pami  Paracoccus aminophilus
Pathway
pami00121  Secondary bile acid biosynthesis
Brite
KEGG Orthology (KO) [BR:pami00001]
 09100 Metabolism
  09103 Lipid metabolism
   00121 Secondary bile acid biosynthesis
    JCM7686_1119
Enzymes [BR:pami01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.159  7alpha-hydroxysteroid dehydrogenase
     JCM7686_1119
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short 2-Hacid_dh_C KR Epimerase 3HCDH_N THF_DHG_CYH_C
Motif
Other DBs
NCBI-ProteinID: AGT08228
UniProt: S5YA10
Position
1101676..1102482
Genome map
AA seq 268 aa AA seqDB search
MSSSIQGKTAIVTGAGKGIGLAIARHFRQAGANVVFADNDERALEDELGAEMNGQGSVRG
FAGDLGQKLTQANLVSATIDAFERVDILVNAHRAVQACDPMSTDEDLLSEMMRQNMTSAL
KLSQLVAKRMTTQAREEEPEIQAGSIINVISLAADRPQPLMLAYSIASAAQAQASRSMAM
ALAGQKIRVNGIAFASIMSNVMQSSLKSDPALRERLVAATPLARIAGAEELGPVAEFLAS
EASGFITGQILRVDGGRSLADSLTPPVF
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgagctcttcgatccagggcaagaccgcgattgtcactggcgcgggcaaaggcatcggg
ctggcgattgcgcgccatttccgtcaggctggcgccaatgtcgtctttgccgataatgac
gaacgcgcgctggaggatgagctcggcgccgagatgaacgggcagggcagcgtgcgcggc
tttgccggagatcttggccagaagctgacccaagccaatcttgtttctgcgacgatcgac
gctttcgagcgggtcgatattctggtgaatgcccatcgcgcggtgcaggcctgcgatccg
atgtccaccgatgaggatcttctgagcgagatgatgcgccagaacatgacctcggcgctg
aagctttcgcagctcgtcgccaagcgcatgacgacgcaggcacgcgaggaagagcccgag
attcaggcgggctcgatcatcaatgtgatttcgcttgcggcggatcggccccagcctttg
atgctggcctattcgatcgcgagcgcggcgcaggcgcaggcctcgcgctcgatggcgatg
gccttggccgggcagaagatccgggtgaacggcatcgcctttgccagcatcatgtcgaat
gtgatgcaatcgagcctcaaatccgacccggcgctgcgcgagcggctggttgcggcgacg
ccgcttgcccggattgcgggcgccgaagagttgggcccggtcgcggaatttctggcaagc
gaggcctcgggctttatcaccggccagattctgcgggtcgatggcgggcgcagcctcgcc
gattctctgacgccgccggtcttctga

DBGET integrated database retrieval system