KEGG   Paracoccus aminophilus: JCM7686_1383Help
Entry
JCM7686_1383      CDS       T02792                                 

Definition
(GenBank) threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
pami  Paracoccus aminophilus
Pathway
pami00260  Glycine, serine and threonine metabolism
pami01100  Metabolic pathways
pami01110  Biosynthesis of secondary metabolites
pami01120  Microbial metabolism in diverse environments
pami01130  Biosynthesis of antibiotics
pami01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pami00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    JCM7686_1383
Enzymes [BR:pami01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     JCM7686_1383
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: AGT08484
UniProt: S5XMG5
Position
1369575..1370621
Genome map
AA seq 348 aa AA seqDB search
MNFASDNTGRVHPKVMAALAAANEGNLPSYGTDAITRAAQDRLRDVLDAPDAAVHFVSTG
TAANALSLSLMAPGWGRVFCHESAHIQTSETGAPEFFMGGGKLLLVEGEGGKMTPESFAE
ALKRAGGDSVHAGQNAGLSLTNATEWGRVYQASEVAALAAAAREIGLPVHMDGARFANAV
AGQNASPAEMTWRAGVDILSFGGTKNGCMGAEAVVLFDPEKSMEFEYRRKRGGHLFSKHR
YLAAQMLALLDGGLWLEIAGHANTMARELANGLSGIAGVTLDQPVESNGVFANFPVEMIE
RLAEAGASFHYWPNEPEGEESHASLRFICGWDTRPEEVEAVLSLLRQG
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgaatttcgcttcggacaacaccggccgcgttcatccgaaggtcatggcagctctggct
gctgcgaatgagggcaatctgccgtcttacggcaccgatgcgatcacccgcgcggcgcag
gatcggctgcgcgatgtgctggacgcgccggatgcggcggttcatttcgtctcgaccggc
acggcggccaatgcgctgtcgctctcgctgatggcaccgggttgggggcgcgtcttctgc
catgaaagcgcccatatccagaccagcgaaaccggcgcgcccgagttcttcatgggcggc
ggcaagctgcttttggtcgaaggcgagggcggaaagatgacgcccgagagcttcgccgag
gcgctgaaacgcgccggaggcgactcggtccatgccgggcaaaatgccgggctgtcgctg
accaatgccaccgaatggggtcgggtctatcaagcctccgaggtcgcggccttggccgct
gccgcacgcgagatcggcctcccggtccatatggacggggcgcggtttgccaatgcggtc
gcgggccagaacgcgtcgcccgccgagatgacctggcgcgccggggtcgatatcctgtcc
ttcggcgggaccaagaacggctgcatgggcgcggaggccgtcgtgctgttcgatcccgag
aagtcgatggaattcgaatatcggcgcaagcgtggcggtcatctcttctcgaaacaccgc
tatctggcggcacagatgctcgcgctgcttgacggtggactatggcttgaaatcgcgggt
catgccaataccatggcgcgcgaattggcgaatgggctttccgggatcgccggggtgacg
ctcgaccaacccgttgaatcaaatggtgtctttgcgaatttcccggtcgagatgatcgag
cgtctggccgaggccggggccagcttccattactggccgaacgagcccgagggcgaggaa
agccatgcctcgctgcgcttcatctgcggctgggatacccgccccgaagaggtcgaggcg
gttctgtcactgctccgtcagggctaa

DBGET integrated database retrieval system