KEGG   Paracoccus aminophilus: JCM7686_2369Help
Entry
JCM7686_2369      CDS       T02792                                 

Definition
(GenBank) AAA ATPase
  KO
K01144  exodeoxyribonuclease V [EC:3.1.11.5]
Organism
pami  Paracoccus aminophilus
Brite
KEGG Orthology (KO) [BR:pami00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    JCM7686_2369
Enzymes [BR:pami01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     JCM7686_2369
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 UvrD_C_2 AAA_19 UvrD_C AAA_16 AAA_22 NACHT AAA_33 AAA_11 DUF2075 PIF1 MobB ABC_tran Ploopntkinase3 cobW CbiA KAP_NTPase UvrD-helicase Pox_A32
Motif
Other DBs
NCBI-ProteinID: AGT09439
UniProt: S5XPY7
Position
2457424..2458950
Genome map
AA seq 508 aa AA seqDB search
MSLPTLSSDQAEAWDTLAAVLEEAGIDLTAEEIHPPEPGKGRVIAVIGKAGSGKTLLLAE
LTRALKDAGVELISGDYEGKKKKDRRTVAVLAPTNKAAFVLRMRGVPATTIHRILYTPVY
DPEYERIAEWLVGVGERPQIPELTEEALDRAKASYDLHASIPGALAAAGLRGSDFIRGWK
RREDPLDVGLIDESSMLDERQFEDLREIFPVLILFGDPAQLAPVGQSGEMVFDRLATSQK
LILHRIHRQADDSPILDLAHALADPALDFAGFERMVQDAAARDPRVVWAERVDSDLMAQS
PVLVWRNATRVKLIQAFRTAYGAPPDALLPGEPLICDGLELPLKHRKKRIDLEARGLIKG
AQVVYLGPGRKPGFSRLHVIGAEDPRLSAASIVKIEMPDVEEPFIPFPAPMGAAFLHGAA
VTIHKAQGSQWPDVQIFAPDISAAAWSNRTEAGIPLWKRLAYVGITRAQERLFWVVRSRL
ARPSGPLSIEHLPQAAPLLELKAQSDED
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgagccttcccaccctctcctccgatcaggccgaagcctgggacacccttgccgccgtg
cttgaagaggccggcattgacctgaccgccgaagagatccacccgcccgagcccggcaag
ggccgggtcatcgcggtgatcggcaaggcgggctcgggcaagacgcttttgctggccgaa
ctgacccgcgcgctgaaagacgcgggcgtcgagctgatttcgggcgattacgagggcaag
aagaaaaaggaccgccgcacggtcgcggttctggcccccaccaacaaggcggctttcgtt
ctgcggatgcgcggcgtgcccgccacgacgatccaccgcatcctttataccccggtctat
gaccccgaatatgagcggatcgccgaatggctggtcggcgtcggcgagcggccgcagatc
cccgagctgaccgaagaggcgctcgaccgcgccaaggcctcctatgacctccatgcctcg
atcccgggcgccttggcggcggcgggcctgcgcggctcggacttcatccggggctggaaa
cggcgcgaggatcctttggatgtcgggctgatcgacgaaagctcgatgctcgacgagcgt
cagttcgaagatctgcgcgagatctttccggtcctgatcctctttggcgatccggcccag
cttgctcctgtgggtcagtccggcgagatggtctttgaccggctggcgacaagccaaaag
ctgatcctgcaccgcatccaccgtcaggccgatgacagcccgatccttgatctcgcccat
gctttggccgatcccgcgctggatttcgccgggttcgagcgcatggtccaagacgccgcc
gctcgcgatccgcgcgtggtctgggccgagcgcgttgacagcgatctcatggcgcaaagc
ccggttctggtctggcgcaatgcgacccgcgtcaagctgatccaggccttccgcaccgct
tacggcgcgccgcccgatgcgcttttgccgggcgagcccttgatttgcgacgggctcgag
ctgcccctcaagcaccgcaagaagcgcattgatcttgaggcgcgcgggctgatcaagggc
gcgcaggtcgtctatcttgggcccggccgcaagcccggcttttcgcgcctccatgtcatc
ggcgccgaggatccgcgcctttccgccgcctcgatcgtcaagatcgaaatgcccgatgtc
gaagagccgttcatccccttccccgcacccatgggcgcggccttcctgcatggggcggcg
gtgacgatccacaaggcgcagggcagtcaatggcccgatgtccagatcttcgcccccgac
atttccgccgccgcctggtcgaaccggaccgaggccgggatccccttgtggaagcgtctg
gcctatgtcggcatcacccgcgcacaagagcggcttttctgggtcgtgcgctcgcggctg
gcgcggccctcgggaccgctctcgatcgagcatctgccgcaggcggcgccgctgctggaa
ctcaaggcgcagagcgacgaggactag

DBGET integrated database retrieval system