KEGG   Paracoccus aminophilus: JCM7686_2559Help
Entry
JCM7686_2559      CDS       T02792                                 

Definition
(GenBank) aspartyl/glutamyl-tRNA amidotransferase subunit A
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
pami  Paracoccus aminophilus
Pathway
pami00970  Aminoacyl-tRNA biosynthesis
pami01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pami00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    JCM7686_2559
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:pami03029]
    JCM7686_2559
Enzymes [BR:pami01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     JCM7686_2559
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     JCM7686_2559
Mitochondrial biogenesis [BR:pami03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    JCM7686_2559
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase Peptidase_M9_N
Motif
Other DBs
NCBI-ProteinID: AGT09627
UniProt: S5XWH3
Position
complement(2658460..2659941)
Genome map
AA seq 493 aa AA seqDB search
MTDLNKLTIAAARDGLRAKDFTATELTEACLTAINGADKLNAFVHKTPEIAREMAARADA
RLASGDAPAMCGIPVGIKDVFCTKGVPSQAASRILEGFKPEYESTVTQNLWDAGAIMLGK
LNMDEFAMGSSNESSVYGKAINPWKIDARDLTPGGSSGGSAAAVAADLCLAATGTDTGGS
IRQPAAFTGTVGIKPTYGRVSRWGTIAYASSLDQAGPMTKTVRDAAIMLGAIASVDAKDS
TSADRPVPDYEAALSGDIRGKKIGIPREYRIEGLNAEVDAVWNKAADMLRDAGAEIVDIS
LPHAKYALPAYYVIAPAEASSNLARYDGVRFGRRAKLGAGDGIVEMYERTRAEGFGPEVQ
RRVMIGTYVLSAGFYDAYYNRARKVRALIKRDFDQAYAAGVDAILAPATPSPAFGLGEMT
GADPVEMYLNDVFTVTLNLAGLPGVSVPVGLSASGLPLGMQLIGRPWEEGELLNLAQVLE
NAAGFEAKPERWW
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatctgaacaaactcaccattgccgccgcccgcgacgggctgcgcgcgaaggat
ttcaccgcgaccgagctgaccgaggcctgcctgaccgccatcaatggcgccgacaagctc
aatgctttcgtccacaagacccccgagatcgcccgcgagatggcggcccgcgccgatgcg
cgtctggcctcgggcgatgcgcctgcgatgtgcggcattccggtcggcatcaaggatgtg
ttctgcaccaagggcgtgccctcgcaggccgcgagccgcattctcgaaggcttcaagccc
gaatatgaatcgaccgtgacccagaacctctgggatgctggcgcgatcatgctcggcaag
ctcaatatggacgaattcgccatgggctcgtcgaacgagtcgagcgtctatggcaaggcg
atcaacccttggaagatcgatgcgcgcgacctgacgccgggcggctcttcgggcggttcg
gcggcggctgtggcggcggatctctgccttgctgcgaccggcaccgataccggcggctcg
atccgccagcctgcggccttcaccggcacggtgggcatcaagccgacctatggccgcgtt
agccgctggggcacgattgcctatgcaagctcgctcgatcaggcgggcccgatgaccaag
acggtgcgcgatgcggcgatcatgctgggcgcgatcgcctcggtcgatgccaaggattcg
accagcgccgaccgcccagtcccggattacgaggccgcgctgagcggagacattcgcggc
aagaagatcggcattccgcgcgaataccgcatcgagggcctgaatgccgaggtcgatgcc
gtctggaacaaggccgccgacatgctgcgcgatgcgggcgccgagatcgtcgatatctcg
ctgccccacgccaaatatgcgctgcccgcctattacgtcatcgcgccggcggaggcctcg
tcgaacctcgcgcgctatgacggcgtccgctttggccgccgcgcgaaactcggcgccggt
gacggcatcgtcgagatgtatgagcgcacccgcgccgaaggcttcggccccgaggtgcag
cgccgcgtgatgatcgggacttacgttctgtcggctggcttttacgacgcctattacaac
cgcgcccgtaaagtgcgcgcgctgatcaaacgcgacttcgatcaggcctatgcggcgggc
gtcgatgcgattctcgctcccgcgacgccgtctccggcttttggtctgggcgagatgacg
ggcgccgatccggtcgagatgtatctcaacgacgtcttcaccgtgacgctgaaccttgcc
ggtctgcccggcgtttcggttccggtcgggctgtcggccagcggtctgccgcttggtatg
cagctgattggccgtccgtgggaggaaggcgagctgctgaaccttgcgcaagtcctcgaa
aatgcggcaggcttcgaggcgaaaccggaacgctggtggtaa

DBGET integrated database retrieval system