KEGG   Paracoccus aminophilus: JCM7686_3064Help
Entry
JCM7686_3064      CDS       T02792                                 

Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
pami  Paracoccus aminophilus
Pathway
pami00450  Selenocompound metabolism
pami00970  Aminoacyl-tRNA biosynthesis
pami01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pami00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    JCM7686_3064
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    JCM7686_3064
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:pami01007]
    JCM7686_3064
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:pami03016]
    JCM7686_3064
Enzymes [BR:pami01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     JCM7686_3064
Amino acid related enzymes [BR:pami01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   JCM7686_3064
Transfer RNA biogenesis [BR:pami03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    JCM7686_3064
 Prokaryotic type
   Other AARSs
    JCM7686_3064
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 Anticodon_1 zinc_ribbon_4
Motif
Other DBs
NCBI-ProteinID: AGT10100
UniProt: S5Y2Y0
Position
3166624..3168342
Genome map
AA seq 572 aa AA seqDB search
MARHLITSAIPYINGIKHLGNLVGSQLPADLYARYLRGRGDEVMFICGTDEHGTPAELAA
QKAGKPVAVYCAEMHDVQADIARRFGLSFDHFGRSSSERNHILTQHLAGKLDENGFITEV
EERQVYSIDDRRFLPDRYIEGTCPNCGYDKARGDQCENCTKQLDPTDLINPRSAISGSTN
LEVRATKHLYLRQRALRDQIETWIDSKKDWPILTTSIAKKWLNDGDGLQDRGITRDLDWG
IPVKKGDQPWPGMEGKVFYVWFDAPIAYIAATAEGADARGEPDAAWRRWWRKDEGAEDVT
YTQFMGKDNVPFHTLSFPATIIGSGEPWKLVDYIKSFNYLTYDGGQFSTSQGRGVFMDQA
LSILPADYWRWWLLSHAPESGDSEFTWDNFQQSVNKDLADVLGNFVSRITKFCRSKFGEV
VPDGGSYGPEEEALIADLTARVRAYEGFMAHMEVRKSAAELRAIWVSGNEYLQSAAPWST
FKTDPEKAAMQVRLGLNLIRLYAVLSAPFIPFAADAMLEGMQTENRDWPEDVPAALQALG
AGHAFTTPEVLFAKISDEQREEWQDRFKGIRS
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgccatctcatcacctcggcaattccctatatcaacggcatcaagcatctgggc
aacctcgtcggcagccagttgccggcggatctttacgcccgctatctgcgcgggcgcggc
gatgaggtgatgttcatctgcggcactgacgagcatggcacgccggcggaactcgccgcg
cagaaggccggcaaaccggtcgctgtctattgcgcggaaatgcatgatgtgcaggccgat
atcgcgcgccgctttggcctgtccttcgaccatttcggccgctcgtcgagcgagcgcaac
catatcctgacccagcatcttgcgggcaagcttgacgaaaacggcttcatcaccgaagtc
gaagagcgtcaggtctattcgatcgacgaccgccgcttcctgcccgaccgctatatcgag
ggcacctgcccgaattgcggctatgacaaggcgcgcggcgatcaatgcgaaaactgcacc
aagcagcttgacccgaccgatctgatcaatccgcgctcggcaatctcgggctcgaccaat
ctcgaggtccgcgcgaccaagcacctctatctgcgccagcgcgctttgcgcgaccagatc
gagacctggatcgacagcaaaaaggactggccgatcctgacgacttcgatcgccaagaaa
tggctgaacgacggcgacgggttgcaggatcgcggcatcacgcgcgatctcgactggggc
attccggtcaagaagggtgatcagccctggccgggtatggagggcaaggtcttctatgtc
tggttcgatgcgcccatcgcctatatcgcggccaccgccgagggcgcggatgcgcgcggc
gagcccgatgccgcatggcggcgctggtggcgcaaggatgagggcgccgaggatgtcacc
tatacccagttcatgggcaaggataacgtccccttccatacgctctcgttcccggcgacg
atcatcggctcgggcgagccgtggaagctggtcgattacatcaaatccttcaactacctg
acctatgacggcggccagttctcgaccagccaaggccggggtgtcttcatggatcaggcg
ctctcgatcctgcccgccgattactggcgttggtggctgcttagccatgcgccggaatcg
ggcgacagcgagttcacctgggacaatttccagcaatcggtgaacaaggatctcgccgat
gttctgggcaatttcgtcagccggatcacgaaattctgccgctcgaaattcggcgaggtc
gtgccggacggtggcagctacggccccgaggaagaggcgctgatcgccgatctgaccgcc
cgcgtccgtgcctatgaaggtttcatggcgcatatggaggtccgcaaatccgccgccgag
ctgcgcgcgatctgggtctcgggcaatgaatatctgcaatcggcagcaccctggtcgacc
ttcaagaccgaccccgagaaagccgcgatgcaggtccgtctgggccttaacctgatccgg
ctttacgcagttctgtccgcgcccttcattcccttcgccgctgatgcgatgctggaaggg
atgcagaccgaaaaccgcgattggcccgaagacgtgcccgccgcgctgcaagctctgggc
gccggtcatgccttcaccacccccgaggtgcttttcgccaagatcagcgacgagcagcgc
gaggaatggcaggatcgtttcaagggcatccgcagctaa

DBGET integrated database retrieval system