KEGG   Paracoccus aminophilus: JCM7686_3066Help
Entry
JCM7686_3066      CDS       T02792                                 

Definition
(GenBank) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
pami  Paracoccus aminophilus
Pathway
pami00220  Arginine biosynthesis
pami00330  Arginine and proline metabolism
pami01100  Metabolic pathways
pami01110  Biosynthesis of secondary metabolites
pami01130  Biosynthesis of antibiotics
pami01230  Biosynthesis of amino acids
Module
pami_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:pami00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    JCM7686_3066
   00330 Arginine and proline metabolism
    JCM7686_3066
Enzymes [BR:pami01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     JCM7686_3066
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: AGT10102
UniProt: S5XXT8
Position
3170880..3171800
Genome map
AA seq 306 aa AA seqDB search
MTHCILIGAPVDEGQRRPGCLMGPMAYRVAGIAQTLAELGHTVEDRGDVAPLPGRGEIHS
NPAIHHLPETIAWTEALAAAATTAMADGMPVFMGGDHSLSLGTVAGVAAHARAAGRPQFV
IWLDAHSDFHTFETSTSGNLHGTPMAYAAGRPGFEPLTPFPAPVPEANICMFGIRSVDPA
ENAALMETDIIVNDMRVLDERGIVAPLREFLDRVHAENGLLHVSLDVDFLDPSIAPAVGT
TVPGGATFREAHLVMELLHESGLVSSLDLVELNPFLDDRGRTAKLMVDLLGSLMGRKVFD
RPTRSY
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgacccattgcatcctgatcggagcccctgtcgatgagggccagcgtcgccccggctgt
ctgatgggcccgatggcctaccgggtcgcgggcattgcccagaccctcgccgagcttggc
catacggtcgaggatcgcggcgatgtcgcgcccctgccgggccgtggcgagatccacagc
aaccccgcgatccatcacctgcccgaaaccatcgcctggaccgaggcgcttgcggcggct
gccaccaccgccatggccgatggaatgccggttttcatgggcggggatcactcgctttcg
cttggcacggtcgcgggggttgccgcccatgcccgcgcggcgggacgaccgcaattcgtg
atctggctcgacgcgcatagcgatttccacacattcgagacctcgacctcgggcaatctg
catggcacgccgatggcctatgccgccgggcggccgggcttcgagccgctgaccccgttc
ccggccccggtgcccgaggccaatatctgcatgttcggcatccgctcggtcgatccggcc
gagaatgctgcgctgatggaaaccgacattatcgtcaatgacatgcgcgtgcttgacgag
cgcggcatcgtcgcgcccttgcgcgaattcctggaccgggtccatgcggaaaacggcctt
ttgcatgtcagcctcgatgtcgatttcctcgacccttcgatcgccccagctgttggcacc
accgtgcccggcggcgcgaccttccgcgaggcgcatctggtcatggagctgctgcatgaa
agcgggctggtcagctcgctggatctggtcgagctgaacccgtttctggacgatcgcggc
cgcaccgcaaagctgatggtcgatcttctgggcagcctgatgggccgcaaggtctttgac
cggccgacgcgaagctattga

DBGET integrated database retrieval system