KEGG   Paracoccus aminophilus: JCM7686_pAMI6p159Help
Entry
JCM7686_pAMI6p159 CDS       T02792                                 

Definition
(GenBank) type VI secretion system protein ImpC
  KO
K11900  type VI secretion system protein ImpC
Organism
pami  Paracoccus aminophilus
Brite
KEGG Orthology (KO) [BR:pami00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pami02044]
    JCM7686_pAMI6p159
Secretion system [BR:pami02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   JCM7686_pAMI6p159
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: VipB TssC BMFP
Motif
Other DBs
NCBI-ProteinID: AGT11489
UniProt: S5XVF0
Position
pAMI6:complement(189171..190661)
Genome map
AA seq 496 aa AA seqDB search
MAQEAQLQPGASQGLSELDEFSDILRQTIKPRSDVAAKEVDSAVVALVREALDDSTLIAD
DVIDTIDAMLSKLDQKLTEQLNAIMHHDEFQRLEASWRGLAYTINNSETDSSLRVKVMNV
SKKELQQMMRRFPGAKWDKSPLHQRVYEAEFGTLGGKPFGALIGDYFFDHSTPDVALLRD
IGKIAAAAHAPFISSAAPELLGMDSWTEIGVPPDLSEIFDTPDYAGWNSLRDSQNSRYIA
LTMPRVLSREPYGQNSNSVVEEFNYEEETDGRAGEKYAWMNAVHAMAVNINRAHKEYGWT
VQIRGVQSGGEVLNLPAHTFETGDGAKELKCPTEVSITDRREGELSKAGLIGLIHRKHTD
KAAFIGAQTLYRPKKYVDDLATASDNLSSRLPYIFAVSRFSHYLKCMVRDKIGQSPDRLQ
LQTQLQTWVNKYVSGNPESASEREKAKKPLAGAKVEVIEDEENPGYYMGKFYLKPHFQLE
GMDVGMSLVSKLPKGK
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atggcacaggaagcacagctccagcctggtgccagtcagggcctgtccgaactggacgaa
ttctctgacattctgcgccagaccatcaagccgcgcagcgatgtcgcggcgaaagaggtc
gatagtgccgttgtcgcgctggtgcgcgaggccttggacgattccacgctgatcgccgat
gatgtcatcgacacgatcgacgcgatgctgtcgaagctcgaccagaaactgaccgagcag
ctcaacgcgatcatgcatcacgatgagttccaacggctcgaggcctcgtggcgcgggctc
gcctatacgatcaacaactccgagaccgattccagccttcgcgtgaaggtgatgaacgtt
tcgaagaaagaattgcagcagatgatgcgccgtttccccggcgcaaaatgggacaaatcg
cccctgcatcagcgcgtctacgaggccgagttcggcacgcttggcggcaagccgttcggc
gctttgatcggcgactatttcttcgaccattcgacccccgatgtagccttgctgcgcgat
atcggcaagatcgcggccgcggcccatgcgcccttcatctcttcggcagcgcccgagctg
ctgggaatggacagctggaccgaaatcggcgtgccgcccgatctgtcggagatcttcgac
acgcccgattatgccggttggaacagcctgcgcgattctcagaactcgcgttatatcgcg
ctgaccatgccgcgcgttctctcgcgcgaaccctatggtcagaattcgaactcggtggtt
gaggaattcaactacgaggaagaaaccgatgggcgtgcgggcgagaaatacgcctggatg
aacgcggtccatgccatggccgttaacatcaaccgcgcgcataaggaatatggctggacg
gtgcagatccgtggcgtccagtcgggcggcgaggttttgaacctgcccgcgcatacgttc
gaaaccggcgacggcgcgaaagagctgaaatgcccgaccgaggtttcgatcaccgaccgg
cgtgaaggtgaattgtcgaaagccggtctgatcggccttattcaccgcaagcatacggat
aaagccgcctttatcggcgcgcaaaccctgtatcgcccgaagaaatatgtcgatgatctg
gcaaccgcttcggacaatttgtcctcgcgcctgccttatatcttcgcagtgtcgcgtttc
agccattatctgaagtgtatggtgcgcgacaagatcgggcaaagcccggaccgtctgcaa
ctgcaaacccagctgcagacttgggttaacaaatatgtttcaggcaatcccgaaagcgca
agcgagcgggaaaaggcgaaaaagcctttggccggagctaaggtggaagtgatcgaggat
gaggagaaccccggctactacatggggaaattctacctcaagccgcacttccagcttgaa
ggaatggatgtcgggatgtctctcgtctccaaattgccgaaaggcaagtaa

DBGET integrated database retrieval system