KEGG   Paracoccus aminophilus: JCM7686_pAMI6p161Help
Entry
JCM7686_pAMI6p161 CDS       T02792                                 

Definition
(GenBank) type VI secretion system protein ImpA
  KO
K11902  type VI secretion system protein ImpA
Organism
pami  Paracoccus aminophilus
Brite
KEGG Orthology (KO) [BR:pami00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pami02044]
    JCM7686_pAMI6p161
Secretion system [BR:pami02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   JCM7686_pAMI6p161
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ImpA_N TctC
Motif
Other DBs
NCBI-ProteinID: AGT11491
UniProt: S5Z263
Position
pAMI6:complement(191254..192618)
Genome map
AA seq 454 aa AA seqDB search
MALDWLLDPVTEEAPCGPDLERSDDGEFLDYYFEAEGRLPERYFTPGAPNLLGGTEDLVF
DPRSVQLKREVGAITALLQRSRDLRLLSLLARFQILAARPADFATTLEAMAELMAARLNE
VHPQLDEGVSERRGALDALAEQTTVVMPLVYLPLLSHADVSYRRYLVASGEVVPRGAEAE
SEATTADLISLLKNPSNAPALSQLFAELTRAALALRRIAGLCMTNGHRAFTPDFTPALDT
ISDLQRLIREAVPGLTPWSETADAALPEVAAPIEAATAAPEDSAPVAVVAPIPTAGAVQI
ANHAEARATIEAAETYLAAFEPSSLSLLLVTQARLLVGKSIVEAIELLRPQQAELASFNL
GSGLGFSLDMGRLRMLAQSVPGNQGDSPAAAETKPAAIRDRGELAASLRGVEDFYLRNEP
ASPVPVLLGGARTMLTKTFDAILSELLPSEAQQV
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atggctttggactggcttctggaccccgtgacggaagaagcgccttgcgggcccgatctc
gaacggtcggatgacggcgaattcctcgactattacttcgaagccgagggccgtctgccc
gagcgctatttcacccccggcgcgccgaatttgctgggcggcaccgaggatctcgtcttt
gatccgcgctcggtccagctcaagcgcgaggtcggtgcgatcaccgcgctcttgcagcgc
agccgcgatctgcggcttctgagcctgctcgcgcggttccagatcctcgccgcccgcccg
gcggatttcgcgaccacgctggaggcgatggccgagctgatggcggcgcggctgaacgag
gtgcatccgcagcttgacgagggcgtctcggaacggcgcggggcgctcgatgctttggcc
gagcagacgaccgtggtcatgccgctggtctatctgccgctcttgtcccatgccgatgtc
agctatcgccgctatctggtcgcctcgggcgaggtcgtgccgcgcggggccgaggctgaa
agcgaggcgacgacggcggatctgatctcgctgttgaaaaacccttcgaatgcgcccgcg
ctcagccagctcttcgccgagctgacccgcgcggctttggcgctgcgccggattgcgggc
ctgtgcatgaccaacgggcaccgcgccttcacgccggatttcacgcctgcgctcgacacg
atctccgatctgcaacggctgatccgcgaggctgtgcccgggctgaccccctggagcgaa
accgccgatgcggccctgcccgaggtggctgctccgatcgaggccgccaccgccgccccg
gaggacagcgcgccggtcgctgtcgtcgcgccgatcccgacggcgggggcggtgcagatt
gccaaccatgccgaggcgcgcgcgacgattgaagccgccgaaacctacctcgccgccttc
gagccgtcgtcgctgtcgctgctgctggtgacgcaggcgcggctcctcgtcggcaagtcg
attgtcgaggcgatcgagcttttgcgtccgcagcaggccgagcttgcctcgttcaatttg
ggcagcggtctgggcttctcgctcgacatggggcggctgcggatgttggcgcaatcagtg
ccggggaatcagggtgattctcctgccgctgcggaaactaaacctgcggcaattcgcgat
cgcggggaactcgccgcaagcttgcgcggggtcgaagacttctacctgcgtaacgaacct
gcgagccccgtgccggttctactggggggtgcaaggaccatgctcacgaaaacctttgac
gcgattttgagtgagctcttgccctcggaggcccaacaagtctag

DBGET integrated database retrieval system