KEGG   Paracoccus aminovorans: JCM7685_0511Help
Entry
JCM7685_0511      CDS       T05468                                 

Definition
(GenBank) phosphate permease
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
pamn  Paracoccus aminovorans
Brite
KEGG Orthology (KO) [BR:pamn00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    JCM7685_0511
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: CQR85095
Position
I:complement(502107..503534)
Genome map
AA seq 475 aa AA seqDB search
MTRRSREYRTLDKDLSRVANTERAVMQSGRPVFRLGIALLFMAAAAYAATGVFAGQPALG
IVAAAMAVAAWLGLSIGANDVSNSLSPAVGAGAIGMTSGLLLVAVMEVLGAVIAGAPVTV
TLTQGLVGGTLGQGEATARMMLTALLAAGCWISLATWLDAPVSTTHSVVGAIAGAGLASF
GPGAVNWPELGLIAIGWVISPLLSGALAALLLAALRNRVTEREDRVAAGRVWLPIMVAAT
TGLLASLAAVAWHGLALSTVLALGLAGAGGGWLYARLRIRREIAADRGERLALKKLLGVP
LVTAAAVMGFAHGSNDTSNVAAPLGIILDSLPTQGGLLPQGRLVLLLGGIGIALGVLLFG
RRLVYMVGSKITRLNAARALCISLATSATVLGFSAAGLPVSTTHIAVGGVFGIGFYREWR
DRRLAGALPALPDEERRRRHLVRRSYMRMILGAWLITVPAAALLAAVMVWIGRLL
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgacacgccgttcccgcgaataccggacgctggacaaggatctgagccgcgtcgccaat
accgagcgcgcggtcatgcaatcgggccggccggtgttccggctgggcatcgcgctgctc
ttcatggccgctgccgcctatgccgccaccggggtctttgccggccagccggcgctgggc
atcgtcgccgcggcgatggcggtggcggcctggctagggctgtcgatcggcgcaaacgac
gtgtcgaactcgctgagcccggcggtgggcgccggtgccatcggcatgacctccggcctg
ctgctggtcgccgtgatggaggtgctgggcgcggtcatcgccggcgccccggtcaccgtg
accctgacccaagggctggtcggcggcacgctgggccagggcgaggcgacggcgcggatg
atgctgaccgcgctgctggccgccggctgctggatcagccttgcgacctggctggatgcg
ccggtcagcaccacccattccgtggtcggcgccatcgccggcgccgggctggcgagcttc
ggccccggcgcggtcaactggcccgaactgggcctgatcgcgatcggctgggtgatctct
ccgctgctctcgggcgcgctggcggcgctgctgctggcggcgctgcgcaaccgcgtgacc
gagcgcgaggaccgggtcgccgccggccgggtctggctgccgatcatggtcgcggcgacg
accggcctgctggcttcgctggcggcggtggcctggcacgggctggccttgtcgaccgtg
ctggcgctgggtctggcgggcgcgggcggcggctggctgtatgcccggctgcgcatccgg
cgcgagatcgccgccgaccgcggcgagcgtctggcgctgaaaaagctgctgggcgtgccg
ctggtgacggcggcggcggtgatgggctttgcgcatggctcgaacgacacctcgaacgtg
gcggcgccgctgggcatcatcctggacagcctgccgacgcagggcgggctgctgccgcag
ggccggctggtgctgcttctgggcgggatcggcatcgcgctgggggtgctgctgttcggg
cgccggctggtctatatggtcggcagcaagatcacccggctgaacgccgcccgggcgctg
tgcatctcgctggcgacctcggcgacggtgctggggttttcggcggcggggctgccggtc
tcgaccacgcatatcgccgtgggcggggtgttcggcatcggcttttaccgcgaatggcgc
gaccggaggctggccggcgccctgccggcgctgcccgacgaagagcgccgccgccgccac
ctcgtgcggcgttcctacatgcggatgatcctgggcgcctggctgatcacggtgccggcg
gcggccctgctggccgcggtcatggtctggatcggccggctgctctag

DBGET integrated database retrieval system