KEGG   Paracoccus aminovorans: JCM7685_0531Help
Entry
JCM7685_0531      CDS       T05468                                 

Definition
(GenBank) histidinol-phosphate aminotransferase
  KO
K00817  histidinol-phosphate aminotransferase [EC:2.6.1.9]
Organism
pamn  Paracoccus aminovorans
Pathway
pamn00340  Histidine metabolism
pamn00350  Tyrosine metabolism
pamn00360  Phenylalanine metabolism
pamn00400  Phenylalanine, tyrosine and tryptophan biosynthesis
pamn00401  Novobiocin biosynthesis
pamn01100  Metabolic pathways
pamn01110  Biosynthesis of secondary metabolites
pamn01130  Biosynthesis of antibiotics
pamn01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pamn00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    JCM7685_0531
   00350 Tyrosine metabolism
    JCM7685_0531
   00360 Phenylalanine metabolism
    JCM7685_0531
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    JCM7685_0531
  09110 Biosynthesis of other secondary metabolites
   00401 Novobiocin biosynthesis
    JCM7685_0531
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:pamn01007]
    JCM7685_0531
Enzymes [BR:pamn01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.9  histidinol-phosphate transaminase
     JCM7685_0531
Amino acid related enzymes [BR:pamn01007]
 Aminotransferase (transaminase)
  Class II
   JCM7685_0531
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: CQR85115
Position
I:523761..524864
Genome map
AA seq 367 aa AA seqDB search
MTRFRFAPLVAALPASVPFTGPETLERRAGRPFRARLGANENGFGPSPRAVAAMQRAAVE
VWKYGDPDSHDLRHALAAHHGVAPENVMVGEGIDGLLGLLVRLTVAPGEAVVTSDGAYPT
FNYHVAGFGGRLVKVPYRDDAEDPGALAGAARDQNARLVYLANPDNPMGSWHTAGRIEAL
LDDLPAASLLVLDEAYAEFAPEEAIPRIDPEDARVIRLRTFSKAYAMAGARVGYAIGPAE
LIASFDRIRNHFGMNRISQIGAVAALEDADWLAHVRAEVAASRDRLAGIAQSNGLTALPS
ATNFVALDTHCDGAFAGALLQTLARQGIFARMPGVAPMDRCIRVSCGPEPDMAAFAEALP
RALKALS
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgacccggttccgcttcgccccccttgtcgccgcgctgcccgccagcgtgcccttcacc
ggacccgagacgctggagcggcgtgccggccggcctttccgcgcccggctgggggccaat
gaaaacggcttcggcccgtcgccgcgggcggtggcggccatgcagcgggcggcggtcgag
gtctggaaatacggtgaccccgacagccacgacctgcgccacgcgctggctgcgcatcat
ggagtcgcgccggagaacgtcatggtgggggagggcatcgacgggcttctgggccttctg
gtgcggctgacggtggcgccgggcgaggcggtggtgacctcggacggcgcctatccgacc
ttcaactaccatgtcgcgggattcggcggccggctggtcaaggtgccctatcgcgacgat
gccgaggatcccggggcgctggccggcgccgcccgcgaccagaacgcgcggctggtctat
ctggcgaatccggacaatcccatgggcagctggcataccgccggccgcatcgaggccctg
ctggacgacctgcccgccgccagcctgctggttctggacgaggcctatgccgaattcgcc
cccgaggaagccatacctcggatcgaccccgaggatgcgcgggtgatccggcttcgcacc
ttttccaaggcctatgccatggccggcgctcgcgtgggctatgcgatcggtccggccgag
ctgatcgccagcttcgaccgcatccgcaaccatttcggcatgaaccgcatctcgcagatc
ggggcggtggccgcgctcgaagatgcggactggctggcgcatgtccgggccgaggtggcc
gcgtcccgtgaccgcctcgcggggatcgcgcagtcgaacgggctgacggcgctgccctcg
gcgacgaatttcgtcgccctcgacacgcattgcgacggcgccttcgctggcgcgctgctc
cagacgctggcgcggcagggcatcttcgcccgcatgccgggcgtcgcgccgatggatcgc
tgcatccgtgtctcttgcggccccgagcctgacatggccgccttcgccgaggcgctgccc
cgcgcgctcaaggcgctgagctga

DBGET integrated database retrieval system