KEGG   Paracoccus aminovorans: JCM7685_0542Help
Entry
JCM7685_0542      CDS       T05468                                 

Definition
(GenBank) succinyl-CoA:3-ketoacid coenzyme A transferase, subunit B
  KO
K01029  3-oxoacid CoA-transferase subunit B [EC:2.8.3.5]
Organism
pamn  Paracoccus aminovorans
Pathway
pamn00072  Synthesis and degradation of ketone bodies
pamn00280  Valine, leucine and isoleucine degradation
pamn00650  Butanoate metabolism
pamn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pamn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    JCM7685_0542
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    JCM7685_0542
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    JCM7685_0542
Enzymes [BR:pamn01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.5  3-oxoacid CoA-transferase
     JCM7685_0542
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_trans AcetylCoA_hyd_C IF-2B
Motif
Other DBs
NCBI-ProteinID: CQR85126
Position
I:535302..535931
Genome map
AA seq 209 aa AA seqDB search
MAWDRNQMAARAAQELQDGWYVNLGIGIPTLVANYIPEGVHVTLQSENGMLGIGPFPFEG
EEDPDLINAGKQTVTELPQTAYFDSSESFAMIRGGKIAMAILGAMEVAENGDLANWMIPG
KLVKGMGGAMDLVAGVGRVVVVMDHSSKHGESKVLKACTLPLTGQKVVNRIITNLGVLDV
VPGGLRIVELAEGVSEDAMRAATEATIVG
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atggcatgggaccgcaaccagatggcggcgcgggccgcgcaggagctgcaggacggctgg
tacgtgaacctcggcatcggcatcccgacgctggtcgcgaactacatccccgagggggtg
catgtgacgctgcaatcggaaaacggcatgctgggcatcgggccgtttccgttcgagggc
gaagaggacccggacctgatcaacgccggcaagcagacggtgaccgagttgccgcagacc
gcctatttcgacagttccgaaagcttcgccatgatccggggcggcaagatcgcgatggcg
atcctgggcgcgatggaggtggccgagaacggcgacctggcgaactggatgatcccgggc
aagctggtcaagggcatgggcggcgcgatggacctggtggccggggtcggtcgcgtggtg
gtggtgatggaccacagctcgaagcacggcgagtcgaaggtgctgaaggcctgcacgctg
ccgctgaccgggcagaaggtggtgaaccggatcatcaccaacctgggcgtgctggacgtg
gttccgggcgggctgcggatcgtcgagctggccgaaggcgtcagcgaggatgcgatgcgc
gccgcgaccgaggcgaccatcgtcgggtga

DBGET integrated database retrieval system