KEGG   Paracoccus aminovorans: JCM7685_0554Help
Entry
JCM7685_0554      CDS       T05468                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
pamn  Paracoccus aminovorans
Pathway
pamn00010  Glycolysis / Gluconeogenesis
pamn00071  Fatty acid degradation
pamn00350  Tyrosine metabolism
pamn00625  Chloroalkane and chloroalkene degradation
pamn00626  Naphthalene degradation
pamn01100  Metabolic pathways
pamn01110  Biosynthesis of secondary metabolites
pamn01120  Microbial metabolism in diverse environments
pamn01130  Biosynthesis of antibiotics
pamn01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:pamn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    JCM7685_0554
  09103 Lipid metabolism
   00071 Fatty acid degradation
    JCM7685_0554
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    JCM7685_0554
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    JCM7685_0554
   00626 Naphthalene degradation
    JCM7685_0554
Enzymes [BR:pamn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     JCM7685_0554
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N
Motif
Other DBs
NCBI-ProteinID: CQR85138
Position
I:547240..547656
Genome map
AA seq 138 aa AA seqDB search
MALAPLLCAGLIGWRALTMAGQGRRLGLYGFGAAAHIVAQVAAWQGRSVHVFTRPGDRMS
QDFARSLGADWAGGSDQPPPEPLDAAIIFAPLGELVPVALRAVRKGGRVVCAGIHMGRDA
NLPHSNRARIKGQVAPMS
NT seq 417 nt NT seq  +upstreamnt  +downstreamnt
gtggcgctggcgccgctgctctgcgccgggctgatcggctggcgtgcgctgaccatggcc
ggtcagggccggcggctggggctttacggcttcggcgccgcggcccatatcgtcgcgcag
gtggcggcctggcagggccgttcggtccatgtcttcacccggcccggcgaccgcatgtcg
caggattttgcccgcagcctgggcgccgactgggccggcggttcggaccagccgccgccc
gagccgctggacgcggcgatcatcttcgctccgctgggcgaactggtgcccgtggcgctg
cgggcggtgcgcaagggcggccgcgtggtctgcgccggcatccacatgggacgggacgcc
aacctgccgcattccaatcgtgctcgaatcaagggacaggtcgcgccgatgagctga

DBGET integrated database retrieval system