KEGG   Paracoccus aminovorans: pAMV3p0137Help
Entry
pAMV3p0137        CDS       T05468                                 

Definition
(GenBank) 3-octaprenyl-4-hydroxybenzoate carboxy-lyase
  KO
K03186  flavin prenyltransferase [EC:2.5.1.129]
Organism
pamn  Paracoccus aminovorans
Pathway
pamn00130  Ubiquinone and other terpenoid-quinone biosynthesis
pamn01100  Metabolic pathways
pamn01110  Biosynthesis of secondary metabolites
pamn01120  Microbial metabolism in diverse environments
pamn01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:pamn00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    pAMV3p0137
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    pAMV3p0137
Enzymes [BR:pamn01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.129  flavin prenyltransferase
     pAMV3p0137
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flavoprotein
Motif
Other DBs
NCBI-ProteinID: CQR84082
Position
IV:158469..159065
Genome map
AA seq 198 aa AA seqDB search
MNAFAIPRGPSRPRMAVGISGASGVVYGLRLLELLRDLGVETHVTVSRAALLTMVHETEF
KLSDIEARADVLYRSDDVAASISSGSFRTMGMIVAPCSMKTLAEIAQGVTSGLISRAAEV
TLKERRRLVLLARETPLTESHLQNMLAVTRMGGIVAPPVPAFYARPASIDAMVDQTLGRV
LDLFDLDCAGVRRWVKAP
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
gtgaacgcctttgccatcccgcgtgggcccagccgcccccggatggcggtggggatcagc
ggcgcctcgggcgtggtctacggattgcgcctgctggaactgctgcgcgaccttggggtc
gagacgcatgtcaccgtcagccgcgccgcgctgctgaccatggtgcatgaaaccgagttc
aagctttcggacatcgaggcgcgggcggatgtgctttaccgctcggacgatgtggcggcc
tcgatctccagcggctcgttccgcaccatgggcatgatcgtcgcgccctgttcgatgaag
accctggccgagatcgcgcagggcgtcacctcgggcctgatcagccgcgcggccgaggtc
acgctgaaggagcgccgccggctggtgctgctggcgcgcgagacgccgctgaccgaaagc
catctgcaaaacatgctggccgtgacgcgcatggggggcatcgtcgcacccccggtcccg
gccttctacgcccggccggccagcatcgacgcgatggtggaccagacgctgggccgcgtc
ctcgacctgttcgatctggattgcgccggcgtgcggcgctgggtcaaggcgccctga

DBGET integrated database retrieval system