KEGG   Podospora anserina: PODANSg10109Help
Entry
PODANSg10109      CDS       T01048                                 

Definition
(RefSeq) hypothetical protein
  KO
K01958  pyruvate carboxylase [EC:6.4.1.1]
Organism
pan  Podospora anserina
Pathway
pan00020  Citrate cycle (TCA cycle)
pan00620  Pyruvate metabolism
pan01100  Metabolic pathways
pan01200  Carbon metabolism
pan01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pan00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PODANSg10109
   00620 Pyruvate metabolism
    PODANSg10109
Enzymes [BR:pan01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.1  pyruvate carboxylase
     PODANSg10109
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CPSase_L_D2 PYC_OADA Biotin_carb_C HMGL-like Biotin_carb_N Biotin_lipoyl Dala_Dala_lig_C Biotin_lipoyl_2 ATP-grasp HlyD_D23 ATP-grasp_3 RimK DUF2118 GARS_A ATPgrasp_ST ATP-grasp_4 NQRA
Motif
Other DBs
NCBI-GeneID: 6197130
NCBI-ProteinID: XP_001913060
UniProt: B2A941
Position
1
AA seq 1117 aa AA seqDB search
MHRQKADEAYVIGKRGQYTPVGAYLASDEIVKIAVEHGAQMIHPGYGFLSENAEFARKVE
AAGLIFIGPSPDVIDALGDKVSARKIAIAANVPVVPGTEGAVEKFEEVKAFTDKYGFPII
IKAAYGGGGRGMRVVREEASLKESFERATSEAKSAFGNGTVFVERFLDKPKHIEVQLLGD
NHGNIVHLYERDCSVQRRHQKVVEIAPAKDLPASVRDAILNDAVRLAKSVNYRNAGTAEF
LVDQQNRYYFIEINPRIQVEHTITEEITGIDIVAAQIQIAAGATLEQLGLTQDRISTRGF
AIQCRITTEDPAKNFQPDTGKIEVYRSAGGNGVRLDGGNGFAGAVITPYYDSMLVKVSCH
GSTYEIARRKVLRALIEFRIRGVKTNIPFLASLLTHPTFIDGNCWTTFIDDTPSLFDLVG
SQNRAQKLLAYLGDLAVNGSSIKGQIGEPKFKGDIIIPELLDDAGKKLDVSSPSQKGWRN
IIVEQGPKAFAKAVRNYKGCLLMDTTWRDAHQSLLATRVRTVDLLNIAKETSHALSNLYA
LECWGGATFDVAFRFLYEDPWDRLRKMRKLIPNIPFQMLLRGANGVAYASLPDNAIDHFV
KQAKDNGVDIFRVFDALNDINQLEVGIKAVQKAGGVCEGTVCYSGDMLNPKKKYSLDYYI
DLVDKLVALDIDVLGIKDMAGVLKPHAATILIGTIRKKYPDLPIHVHTHDSAGTGVASMV
ACAMAGADAVDAATDSLSGMTSQPSINAIIASLDGTDKQPGLNPAHVRALDTYWSQLRLL
YSPFEAHLAGPDPEVYEHEIPGGQLTNMMFQASQLGLGSQWLETKKAYEQANELLGDIVK
VTPTSKVVGDLAQFMVSNKLSPKDVIERAGELDFPGSVLEFLEGMMGQPYGGFPEPFRTK
ALRGRRKLDKRPGLFLEPIDFAKVRKELSRKYGSVTECDVASHIMYPKVFADYKAFIAKY
GDLSVLPTKYFLSKPEIGEEFHVELEKGKVLILKLLAVGPLSENTGQREVFYEMNGEVRQ
VTVDDKQASVENVSRPKADPGDSSQVGAPMAGVLVELRVHEGSEVKKGDPLAVLSAMKME
MVISAPHNGVVSSLQVREGDSVDGSDLVCRITRGDKK
NT seq 3354 nt NT seq  +upstreamnt  +downstreamnt
atgcacagacagaaggccgatgaggcttatgtcattggcaagcgtggacagtacacacct
gttggcgcctaccttgccagcgatgaaatcgtcaagatcgccgttgagcacggtgctcag
atgattcaccctggttatggtttcttgtctgaaaatgccgagttcgctcgcaaggttgag
gctgccggtcttatcttcatcggtccctctcccgacgtcatcgatgcccttggcgacaag
gtctcagccagaaagattgccattgctgcgaacgtaccagtcgtcccaggcaccgagggc
gccgtcgagaagtttgaggaagtcaaggctttcacggacaagtatggcttccccatcatc
atcaaggctgcttatggcggtggtggtcgtggtatgcgtgttgtgcgtgaggaggcttcc
ctcaaggagtccttcgagagagccacctccgaggcgaagagcgccttcgggaacggcacc
gtcttcgttgagcgtttcctcgacaagcccaagcacattgaggttcagctcctcggtgac
aaccatggcaacattgtccacttgtacgagcgtgactgctccgtgcagcgcagacaccaa
aaggtcgtcgaaatcgctccggccaaggatcttcccgccagcgttcgcgatgctatcctg
aacgatgctgtcagactcgccaagtctgtcaactaccgcaacgctggtaccgccgagttc
ctggttgaccagcagaaccgctactactttatcgagatcaacccccgtatccaggtcgaa
cataccatcactgaggaaatcaccggtatcgatatcgttgccgctcagatccagatcgcc
gctggcgctaccctggagcagctcggccttacccaagaccgcatctctactcgcggcttc
gccatccagtgtcgtatcacgaccgaggatccggccaagaacttccagcccgacactggc
aagatcgaggtgtaccgctccgctggcggtaacggtgtgcgtctcgatggtggcaacggc
tttgctggcgccgtcattaccccctactacgacagcatgcttgtcaaggtgtcgtgccac
ggctcaacgtacgaaattgcccgccgcaaggttcttcgcgctcttatcgagttccgcatt
cgcggcgtcaagaccaacatccccttcctggcctctctcctgacccacccaacatttatt
gatggcaactgctggacgacctttattgatgataccccgtccctgtttgacctcgttggc
agtcagaaccgcgcccagaagcttctggcctatcttggtgacctcgccgtcaacggtagc
agcatcaagggtcaaatcggtgagcccaagttcaagggcgacatcatcatccccgagctc
ttggacgatgctggcaagaagctcgatgtgtcttcgccttcgcaaaagggctggcgcaac
atcatcgtcgaacaaggccccaaggctttcgccaaggctgttcgcaactacaagggctgc
ttgctcatggataccacctggcgtgatgcccatcagtctctcctggcgacccgtgtccgc
acagtcgaccttctcaacattgccaaggagaccagccatgcgctctccaacttgtacgct
ctggaatgctggggtggcgccaccttcgatgtcgctttccgcttcttgtacgaggaccct
tgggaccgcctccgcaagatgcgcaagttgatccccaacatccccttccagatgttgctc
cgtggcgccaacggcgttgcttatgcctcgctccctgacaatgccatcgaccacttcgtc
aagcaggccaaggacaacggtgtcgacatcttccgtgtcttcgatgctctcaacgacatc
aaccagctcgaggttggtatcaaggccgtgcaaaaggctggtggtgtctgcgagggtacc
gtctgctacagcggtgacatgctcaaccccaagaagaagtactccttggattactacatt
gaccttgttgacaagcttgttgctctcgacattgatgttcttggcatcaaggacatggcc
ggtgttctcaagccccatgctgccaccatcctcatcggtaccatccgcaagaagtaccct
gacctccccatccacgtccacacccacgactccgcgggtactggtgtggcttccatggtt
gcctgcgccatggccggcgccgatgctgttgacgctgccactgacagcttgtctggtatg
acctcgcagcccagcatcaacgccatcattgcgtcgcttgatggtaccgataagcagccc
ggtctcaaccctgctcacgttcgtgcgcttgatacctactggtctcagcttcgcctcctc
tactcgcccttcgaggctcatcttgcgggtcccgatcctgaggtgtacgagcacgagatt
cctggcggtcagctcaccaacatgatgttccaggcctctcagcttggtcttggctcccag
tggttggagaccaagaaggcttacgagcaagccaacgaactcctcggcgacatcgtcaag
gtcactcctacctccaaggttgttggtgacttggcccagttcatggtgtccaacaagctc
agccccaaggatgtcattgagcgtgctggcgagctcgacttccctggctccgttctcgag
ttcctcgagggtatgatgggccagccgtacggtggtttccccgagccattccgcaccaag
gctctccgtggtcgccgcaagctcgacaagcgccctggtctcttcctcgagcccatcgac
tttgccaaggtcaggaaggagctgtcgcgcaagtacggcagcgttaccgagtgcgacgtg
gccagtcacatcatgtaccccaaggtgttcgccgactacaaggccttcatcgctaagtac
ggagacctcagcgtcttgcctaccaagtacttcctcagcaagcctgagattggcgaggag
ttccacgttgagctcgagaagggtaaggtgttgatcctcaagttgctggccgtcggcccg
ctctccgagaacactggccagcgcgaggtgttctacgaaatgaacggcgaggttcgccaa
gtcactgtcgacgacaagcaggcgtcggtggagaacgtgagccgacccaaggccgaccct
ggcgattcgagccaggtcggtgcccccatggccggtgtgctcgttgagctccgcgtccac
gagggctctgaggtcaagaagggcgatccccttgctgtcctgagcgccatgaagatggaa
atggttatctccgctcctcacaatggtgtagtctcctctctgcaagtgagagaaggcgac
tcagtcgacggctccgacctggtgtgccgcatcaccaggggcgacaagaaatga

DBGET integrated database retrieval system