KEGG   Podospora anserina: PODANSg3187
Entry
PODANSg3187       CDS       T01048                                 

Definition
(RefSeq) hypothetical protein
  KO
K17877  nitrite reductase (NAD(P)H) [EC:1.7.1.4]
Organism
pan  Podospora anserina
Pathway
pan00910  Nitrogen metabolism
pan01100  Metabolic pathways
Module
pan_M00531  Assimilatory nitrate reduction, nitrate => ammonia
pan_M00615  Nitrate assimilation
Brite
KEGG Orthology (KO) [BR:pan00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    PODANSg3187
Enzymes [BR:pan01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.1  With NAD+ or NADP+ as acceptor
    1.7.1.4  nitrite reductase [NAD(P)H]
     PODANSg3187
SSDB
Motif
Pfam: Pyr_redox_2 NIR_SIR Pyr_redox Fer2_BFD Rieske_2 Rieske NIR_SIR_ferr Rubredoxin_C Pyr_redox_3 GIDA FAD_binding_2
Other DBs
NCBI-GeneID: 6190198
NCBI-ProteinID: XP_001906159
UniProt: B2ARP7
Position
4
AA seq 1095 aa
RKKIVVVGLGMVGISFIEKLLKLDARSREYNVVVVGEEPHLAYNRVGLTSFFEHRKIENL
YLNPLEWYTAVPDGALSYHLNTKVTEIHPNRKTITCANGDEVSYDILVLATGSDAVLPKH
TPGHDAKGVFVYRTVEDLEKLIAFSANQKGTVGAVVGGGLLGLEAAKAMMDLGCFEKVKV
IERNRWVLSRQLDADAGGMVVEQVRSLGADVLLSKRVGRIEVTEDNSVKGVHFEDGEYME
CSTICFAIGVRPRDELARQSGILCADRGGGIVVDDSLQTSHPDIYAIGECASWQGQTFGL
IAPGVEMADVLTFNLTQSQHHQPRLYKRPDLSTKLKLLGVEVASFGDFFADRDGPKYLPA
KAKKKPASPLSAVKVLTNGAPPAPVKALTYKDPFLNIYKKYIFSVDGKYLLGGMMIGDTS
DYVKLVPLVKNQKELDVPPSQLILGAKKEGADDGDDLDDDTQICSCHNVTKADVVNTVKD
GTCKSIGEVKSCTKAGTGCGGCMPLVTSIFNKTMKDMGNEVKNTICPHFNYSRADLYNII
MVKRLTTFQEVMKEAGVDPESIGCEACKPTLASIFASLWNKHVMDKPHHGLQETNDRYLG
NIQRNGTYSVVPRVSAGEITPEKLVVIGEVARDYKLYTKITGGQRIDMFGAKKQDLIDIW
KRLVDAGMESGHAYAKSLRTVKSCVGTTWCRYGIGDSVGMAVRLEERYKSLRAPHKIKGG
VSGCVRECAEAQNKDFGLIATEKGFNIFVGGNGGAKPRHSELLAKDVPPTEVIPILDRYL
MFYIRTADKLQRTARWLEALPGGLAYLRSVILDDSLGLNASLEAQMQELVDSFFDEWAEA
INNPEIAAQFKQFANTTETVETMELDTDRGQLRPTFWPSDASAKEDFAGLSKTWSSLTWQ
PMLESSYFKGADDIPNGISAAVKRGDTQLALFRVKGKYYCTQQMCPHKRAFILSDGLVGT
SSSSPSTGEAPYVSCPHHKRNYDLSNGACKNDSELSIATFEVEERDDGMVYVKLPPVEEL
DEKLGTKKWMVKSGEAGEGQLKELDRKLGLETPAGGNWKGHRAKKPGVKPHAENRMRRPV
EVMAGGGGCGSAPDW
NT seq 3288 nt   +upstreamnt  +downstreamnt
cgcaagaagattgttgttgttggtctggggatggtgggcatcagcttcatagagaaactc
ctcaaactcgatgccagatcgcgcgagtacaacgttgtagtagttggcgaagagccgcat
ttggcatacaacagagttggcttgaccagcttctttgagcatcgcaagattgagaacttg
tacctgaatccactagaatggtacacagctgtacctgacggagctctcagctaccacctg
aacaccaaagtcaccgaaatccacccaaacagaaagaccataacctgcgcaaatggtgac
gaagtcagttacgacatcttggttctggctactggctccgatgccgtgctgccaaaacac
acgcccggtcatgacgccaagggcgtctttgtttacaggactgtcgaggacctggagaag
ctcattgctttctcagcgaaccaaaagggcacagttggtgccgtagtaggaggtggcttg
ttgggactcgaagctgccaaggctatgatggacttgggatgcttcgagaaggtcaaagtc
attgagcgcaatcgatgggttctcagccggcaactggacgctgacgcaggcggcatggtt
gtggaacaagtgcgaagcctcggtgctgatgttttgctcagcaagagagtgggcaggatt
gaggtgacggaggacaacagcgtcaagggtgttcactttgaagatggcgagtacatggag
tgctcgaccatttgcttcgctatcggtgtccgaccaagagacgagctggccagacaatca
ggcattctgtgtgctgaccgtggcggcggcatcgtcgttgatgacagccttcagaccagc
catccagacatatacgccattggagagtgcgcaagctggcaaggtcagacgtttggtctg
attgccccgggagtggaaatggctgacgttctcacattcaacctcacacaatcacaacat
catcagccacgattatacaaacgccctgacctgagcacaaagctgaagctgctaggcgtc
gaggttgccagctttggagacttctttgccgaccgtgacgggccaaagtaccttcccgca
aaggcaaagaagaaacccgcctcgccgttatcagcagtcaaggtgctcaccaatggcgcc
cctccggccccagtcaaggccttgacctacaaggacccgtttctcaacatctacaagaag
tacattttctcggtggacggcaaatacctccttggtggcatgatgatcggtgacacatcc
gactacgtcaagcttgtccccttagtcaagaaccagaaagagctcgacgtcccaccgtca
cagcttatccttggtgccaagaaggagggtgctgacgatggtgatgatctcgacgatgac
acccagatttgcagttgccacaatgtcaccaaagcagatgttgtcaacactgtcaaggac
ggtacctgcaagtccatcggggaggtcaagtcttgcacaaaagctggcacaggctgcgga
ggttgcatgcctctcgtgacctccatcttcaacaagactatgaaggacatgggcaatgag
gtcaagaacaccatctgccctcacttcaactacagccgtgctgatctctacaacatcatc
atggtcaagcggttgaccacattccaggaagtgatgaaggaagccggcgtcgacccagag
agcatagggtgcgaagcctgcaagcccacgctggccagcatctttgcaagcttatggaac
aagcacgtcatggataagcctcatcatggtctgcaggaaaccaacgacagatatctgggc
aacatccagcggaacggcacatactcggttgtacctcgagtatcggctggagagattacc
cctgaaaagcttgtggttattggagaggtggcgagagactataagctgtacaccaaaatc
actggtggtcaaagaatcgacatgtttggtgccaagaaacaggatcttattgacatctgg
aagaggttggtggatgctggcatggagtctgggcacgcctatgccaagtccctcaggaca
gtcaagagttgcgtaggtaccacttggtgtcgctatggcatcggtgacagtgtcggcatg
gctgtccgcctggaggagcgatacaagtctcttcgcgctcctcacaagatcaagggtggg
gtgagtggttgtgtgcgcgagtgcgccgaagctcaaaacaaagacttcggcctcatcgcc
accgagaaaggcttcaacatcttcgtgggcggtaatggcggtgccaagcccagacattct
gagctcctcgccaaagacgtgccgcccactgaagtcatccccattctggaccgctacctg
atgttctacatccgcacggccgacaagctccagcgcacagctcgctggctcgaagccctc
ccaggcggtctggcctacctcaggtctgtgatcctcgacgacagcctcggtctcaacgcc
tccctcgaagcccagatgcaagaactggtcgacagcttctttgacgagtgggccgaagcg
atcaacaaccccgagattgccgcgcagttcaagcagttcgccaacacgacagagacagtc
gagacaatggagctcgacacggatcgcggccagctccgcccgactttctggccgagcgac
gcctcggccaaggaagatttcgccgggctgtccaagacgtggtcatcgttgacctggcag
ccgatgctcgagtcatcgtacttcaagggcgcggatgacatccccaacggcatctcggcc
gctgtcaagcgaggcgacacccagctcgcgctctttagagtcaaggggaagtactactgc
actcagcagatgtgccctcacaagcgggcgtttatcctgtctgatggtttggttgggacc
agctcgtcttctcccagcacgggtgaggcgccgtatgtctcttgtccgcaccataagagg
aactatgacttgtccaatggtgcttgcaagaatgattcggagctgtcgattgctaccttc
gaggtggaggagagagacgatgggatggtttatgttaagctgccgccggttgaggagctt
gatgagaagttggggacgaagaagtggatggttaagagtggagaggcgggagagggacag
ttgaaggagttggataggaagctggggttggaaacgccggcgggtgggaactggaaggga
catagggcgaagaagcctggggtgaagccgcatgcggagaataggatgaggaggccggtg
gaggttatggctgggggaggggggtgtgggagtgcaccggattggtga

DBGET integrated database retrieval system