KEGG   Podospora anserina: PODANSg345Help
Entry
PODANSg345        CDS       T01048                                 

Definition
(RefSeq) hypothetical protein
  KO
K01225  cellulose 1,4-beta-cellobiosidase [EC:3.2.1.91]
Organism
pan  Podospora anserina
Pathway
pan00500  Starch and sucrose metabolism
pan01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pan00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PODANSg345
Enzymes [BR:pan01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.91  cellulose 1,4-beta-cellobiosidase (non-reducing end)
     PODANSg345
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_7 CBM_1
Motif
Other DBs
NCBI-GeneID: 6187373
NCBI-ProteinID: XP_001903333
UniProt: B2ACE0
Position
3
AA seq 528 aa AA seqDB search
MVSAKFAALAALVASASAQQVCSLTPESHPPLTWQRCSAGGSCTNVAGSVTLDSNWRWTH
TLQGSTNCYSGNEWDTSICTTGTKCAQNCCVEGAEYAATYGITTSGNQLNLKFVTEGKYS
TNVGSRTYLMENATKYQGFNLLGNEFTFDVDVSNIGCGLNGALYFVSMDLDGGLAKYSGN
KAGAKYGTGYCDAQCPRDIKFINGEANIEGWNPSTNDVNAGAGRYGTCCSEMDIWEANNM
ATAYTPHSCTILDQSRCEGESCGGTYSSDRYGGVCDPDGCDFNSYRMGNKEFYGKGKTVD
TTKKMTVVTQFLKNAAGELSEIKRFYVQNGVVIPNSVSSIPGVPNQNSITQDWCDAQKIA
FGDPDDNTAKGGLRQMGLALDKPMVLVMSIWNDHAAHMLWLDSTYPVDAAGRPGAERGAC
PTTSGVPSEVEAEAPNSNVAFSNIKFGPIGSTFNSGSTNPNPISSSTATTPTSTRVSSTS
TAAQTPTSAPGGTVPRWGQCGGQGYTGPTQCVAPYTCVVSNQWYSQCL
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atggtttccgcaaagttcgccgctctcgctgcccttgtggcctctgcctctgctcagcag
gtgtgctcgctcactcccgagtctcacccccctctgacctggcaaagatgctcggctggt
ggctcctgcaccaacgtcgccggctccgtcaccctcgactccaactggcgctggactcac
accctccagggcagcaccaactgctactctggcaacgagtgggatacctccatctgcacc
accggtaccaagtgcgctcagaactgctgcgttgagggtgccgagtatgctgcgacctat
ggcatcaccaccagcggtaaccagctgaaccttaagttcgtcaccgagggcaagtactcg
accaacgttggctcgcgtacctacctcatggagaacgccaccaagtaccagggcttcaac
ctcctcggcaacgagttcaccttcgatgtcgatgtctccaacattggctgcggtctcaac
ggtgccctctacttcgtctccatggaccttgacggcggtcttgccaagtactctggcaac
aaggctggtgccaagtacggcaccggttactgcgatgcccagtgcccccgtgacatcaag
ttcatcaacggtgaggccaacatcgagggatggaacccctccaccaacgatgtcaacgcc
ggtgccggccgctacggtacttgctgctccgagatggacatctgggaggccaacaacatg
gccactgcctacactcctcactcctgcaccatcctcgaccagagcaggtgcgagggcgag
tcttgcggtggcacttacagctctgaccgctatggcggtgtttgcgatcccgacggatgc
gacttcaactcgtaccgcatgggcaacaaggagttctacggcaagggcaagaccgtcgac
accaccaagaagatgaccgtcgtcacccagttcctcaagaacgccgccggcgagctctcc
gagatcaagcgcttctacgtccagaacggtgtcgtcatccccaactcggtctccagcatc
cccggcgttcccaaccagaactccatcacccaggactggtgcgacgcccagaagatcgcc
ttcggcgacccggatgacaacaccgccaagggcggtctccgccagatgggtcttgccctc
gacaagcccatggtcctcgtcatgtccatctggaacgaccacgccgcccacatgctctgg
ctcgactccacctaccccgtcgacgccgccggccgccccggtgccgagcgcggtgcctgc
cccaccacctcgggtgtcccctccgaggtcgaggccgaggcccccaactccaacgttgcc
ttctccaacatcaagttcggccccatcggctcgaccttcaacagcggcagcaccaacccc
aaccccatctcctcctccaccgccaccacccccacctcgacccgcgtcagcagcacctcg
accgccgcccagactcccaccagcgcccctggtggcaccgtcccccgctggggccagtgc
ggcggccagggctacaccggccctacccagtgcgttgccccctacacctgcgtcgtcagc
aaccagtggtacagccagtgcctctaa

DBGET integrated database retrieval system