KEGG   Podospora anserina: PODANSg3584Help
Entry
PODANSg3584       CDS       T01048                                 

Definition
(RefSeq) hypothetical protein
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
pan  Podospora anserina
Pathway
pan00010  Glycolysis / Gluconeogenesis
pan00071  Fatty acid degradation
pan00350  Tyrosine metabolism
pan01100  Metabolic pathways
pan01110  Biosynthesis of secondary metabolites
pan01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pan00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PODANSg3584
  09103 Lipid metabolism
   00071 Fatty acid degradation
    PODANSg3584
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    PODANSg3584
Enzymes [BR:pan01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     PODANSg3584
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N AlaDh_PNT_C ADH_zinc_N_2 2-Hacid_dh_C adh_short
Motif
Other DBs
NCBI-GeneID: 6190994
NCBI-ProteinID: XP_001906553
UniProt: B2AS51
Position
1
AA seq 337 aa AA seqDB search
MTLKTIPVPTPGPQEILIHILYSGVCHTDLHALNNDWPLPRKTPLVGGHEGAGVVVAKGS
LVASGQGVDVGDYVGIPWLNSTCHHCTFCMQAQEMLCSEAQLSGYTVDGSFQQYAVANAS
HVAKFPKDKGVELDAAAPILCAGLTVYTGLKQSEARPGQYVAIVGAGGGLGSLATQYAKA
MGLHVIAIDGGPEKGESCKKLGAEVYVDYLKSKDLVADVKAATADGLGPHGVLLLAPMEK
PFQQATGYVRSHGTVVCIGMPAGAKVSMPVFDTVVRMVQVKGSYVGNRQDMVEAIDFFLR
GLVRAPVKVVGMSELGGVFDAMRENKVVGRYVLDTSR
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgacgttaaaaaccatccccgtccccactccgggcccccaagaaatcctgatccatatt
ttgtactcgggcgtctgccacaccgacctccacgccctcaacaacgactggcccctgccc
cgcaagacccccctggtgggcggtcacgaaggcgccggcgtcgtggtggccaaaggaagc
ctggttgcttcgggccagggcgtcgatgtcggagactacgtggggatcccctggctcaac
tccacctgccaccactgcaccttttgcatgcaagctcaggagatgctttgcagcgaggcg
cagctctcggggtacacggtcgatggcagcttccagcagtacgctgtcgccaacgcctcg
catgtggccaagttccccaaggataaaggggttgagttggacgctgctgcgcccatcctg
tgtgccggtctgacggtctacactgggctcaagcagagcgaggcccggccggggcagtat
gtggccattgtgggcgcaggtggtggcttgggaagtttggcgacacagtacgccaaggcc
atgggcctacacgtcattgctattgacgggggtccggaaaagggggagagctgcaagaag
ttgggggccgaggtgtatgtggattatttgaagagcaaggacctggtggcggatgtcaag
gcggccacggcggatgggctgggaccgcatggggttttgctgctggccccgatggagaag
ccgtttcaacaggcgaccgggtatgtgagatctcatgggacggtggtttgtattggcatg
ccagcgggtgccaaggtgagcatgccggtgttcgacaccgtggtgaggatggtgcaggtg
aaggggtcttatgttgggaacagacaggatatggtggaggcgatagacttcttcctccgt
gggctggtgagggcaccggtcaaagtggtgggtatgagcgagctcggtggtgtgtttgat
gccatgagggagaacaaagtggtgggaaggtatgtactggataccagtcggtaa

DBGET integrated database retrieval system