KEGG   Podospora anserina: PODANSg3626Help
Entry
PODANSg3626       CDS       T01048                                 

Definition
(RefSeq) hypothetical protein
  KO
K13996  protein disulfide-isomerase [EC:5.3.4.1]
Organism
pan  Podospora anserina
Pathway
pan04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:pan00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    PODANSg3626
Enzymes [BR:pan01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     PODANSg3626
Chaperones and folding catalysts [BR:pan03110]
 Protein folding catalysts
  Protein disulfide isomerase
   PODANSg3626
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thioredoxin Thioredoxin_6 Thioredoxin_8 Thioredoxin_2 AhpC-TSA Thioredoxin_7 Thioredoxin_3 OST3_OST6 Presenilin
Motif
Other DBs
NCBI-GeneID: 6190999
NCBI-ProteinID: XP_001906593
UniProt: B2AS91
Position
1
AA seq 722 aa AA seqDB search
MRLRNLFVFGAAALATASPPSADTEEDITRENTYFNGKKVPPILELTPANYKEELKKSKF
LMVKHFSPWCGHCQEFLPTFQTLYEYYYTSKPVGKDADFTEFYDFRFAELNCVAYADLCT
ENKVAAWPTTILFEDGEPLVTFRGVKHISVLSGAVEDALEKVKPNTRPKTLELPEPGDKT
SPDSKAETEKTEKADAREKGSEKELVKETEKEKETETSTAASADASTEGEATPKKTYTVN
YNTPSQKVTPKPSNPNPKGLSVPLTWELFQSMVTLTQEPWFVKFYAPWCHHCQAMAPNWE
QLAKEMKGRLNIGEVNCDRDTRLCKELRVRGYPSIMFFKGGEKVEYEGLRGLGDFVQYAE
KAIDLSSGVPDVDFDSFKALEEKEEVIFLYFYDHATTSEDFLSLERYPLSLIGKAKLVKT
RDPKLYDRYKITTWPRLIVSREGRPTYYTPLAPREMRDTRMVLNWMKSVWLPLVPELTPS
NARDIMDGKIVVLGVLNRENEDSFRGAIREMKSAANEWMDKQIQLFQIHRQDLRDAKQLR
IEEAEDRGDQRALRNAKNIRINMDRSDMKEATFAWVDGNFWQRWIRTTYGIDAKDGDRVI
INDEDKRRYWDQTSTGNPIVPSRTSILETLNKVTVNPPKLKPKLTIGVIEKMFFDIKMTF
KEHPYLSMGCILGIAFGLFQWLMGRTTRRARSHFKLEEGVGMKESKPSTLFGGSSNTATK
AD
NT seq 2169 nt NT seq  +upstreamnt  +downstreamnt
atgaggctacgcaacctctttgtcttcggggcggccgcgctggcgaccgcctcaccacca
tcagccgacacggaggaggatatcacacgagaaaacacatacttcaatggcaagaaggtt
ccaccgattttggaactcaccccggccaattacaaggaggaattaaaaaagtcaaagttc
ctgatggtcaaacacttcagcccgtggtgcggacattgccaggaatttttgccgaccttc
cagacgttgtacgagtattactacacatcgaagccagtgggcaaggatgccgacttcacc
gagttctatgatttcagattcgctgaactcaactgcgtcgcgtacgccgatttatgtact
gagaacaaggtcgccgcatggccaacaactattttgtttgaggatggcgagcctttggtc
acctttaggggcgtcaagcacattagtgttctcagtggtgctgtcgaagatgcgctcgag
aaggtgaagcccaacaccaggcccaaaaccctcgagctccccgaacctggcgacaagaca
tcccctgattccaaggccgaaaccgagaagaccgagaaggcagatgccagggaaaagggg
tctgaaaaagagctggtcaaggaaactgagaaggagaaggagaccgaaacctccaccgcc
gccagcgccgatgcttcaacggaaggggaagcgacaccaaagaagacctacactgtcaac
tacaataccccttcgcagaaggtcacccctaagccgtcgaaccccaaccccaagggtctc
tccgttcctctgacttgggaattgttccaaagcatggttaccctcacccaggagccttgg
tttgtcaagttttatgcaccatggtgtcaccactgccaggctatggccccgaattgggag
cagttggccaaggaaatgaagggcaggctcaacattggtgaggtcaactgcgaccgcgac
actaggctttgcaaggaactccgcgtccgtggctatccttccatcatgttcttcaagggc
ggtgagaaggtcgagtacgagggccttcgcgggctgggcgactttgtccagtatgctgaa
aaggccattgatctctccagcggggttccggatgtcgatttcgactctttcaaggctctc
gaagagaaggaggaggtcattttcctctacttctacgatcatgctaccaccagcgaagac
ttcctttcgttggagcgttatcctctcagccttattggcaaagccaagttggtcaagacc
cgggatcccaagttgtatgatcgatacaagattaccacttggccacgtctgattgtttcg
cgcgagggccgcccgacttactacactcctctcgcgcctagggaaatgagggataccaga
atggttctcaactggatgaagtccgtctggctcccccttgttcccgagcttaccccgtcc
aacgcccgcgacatcatggacggcaagatcgttgttctgggggttctaaacagagagaat
gaggattctttccgtggcgctatccgtgagatgaagagtgcggccaacgagtggatggat
aagcagattcagctcttccagatccatcgccaggaccttcgtgacgccaagcagctccgc
atcgaggaggccgaggatcgtggtgaccagcgggctctgcgcaacgccaagaacattcgc
atcaacatggacaggtcggacatgaaagaggctacctttgcctgggttgacggcaacttc
tggcagcggtggattcgcaccacttatggcattgatgccaaggacggtgaccgtgttatc
atcaacgatgaagataaacgccggtattgggaccaaactagcactggaaaccccattgtt
ccctcgcgcacatccatccttgaaaccctcaacaaggtcacagtcaacccaccaaagctc
aagccgaagcttaccattggtgtgattgagaagatgttcttcgatatcaagatgaccttc
aaggagcatccctatctcagcatgggctgcatccttggcatcgcttttggtctcttccag
tggctcatgggaagaaccacaagaagagcccgcagtcactttaagctcgaggagggcgtt
ggaatgaaggaatcgaagccctccacgttgtttggcggatcaagcaacactgccaccaaa
gcggactag

DBGET integrated database retrieval system