KEGG   Podospora anserina: PODANSg3856Help
Entry
PODANSg3856       CDS       T01048                                 

Definition
(RefSeq) hypothetical protein
  KO
K01225  cellulose 1,4-beta-cellobiosidase [EC:3.2.1.91]
Organism
pan  Podospora anserina
Pathway
pan00500  Starch and sucrose metabolism
pan01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pan00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PODANSg3856
Enzymes [BR:pan01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.91  cellulose 1,4-beta-cellobiosidase (non-reducing end)
     PODANSg3856
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_7
Motif
Other DBs
NCBI-GeneID: 6191129
NCBI-ProteinID: XP_001906823
UniProt: B2ASX1
Position
6
AA seq 453 aa AA seqDB search
MMMKQYLQYLAAGSLMTGLVAGQGVGTQQTETHPRITWKRCTGKANCTTVQAEVVIDSNW
RWIHTSGGTNCYDGNAWNTAACSTATDCASKCLMEGAGNYQQTYGASTSGDSLTLKFVTK
HEYGTNVGSRFYLMNGASKYQMFTLMNNEFTFDVDLSTVECGLNSALYFVAMEEDGGMRS
YPTNKAGAKYGTGYCDAQCARDLKFVGGKANIEGWRESSNDENAGVGPYGGCCAEIDVWE
SNAHAYAFTPHACENNNYHVCERDTCGGTYSEDRFAGGCDANGCDYNPYRMGNPDFYGKG
KTVDTTKKFTVVTRFQDDNLEQFFVQNGQKILAPAPTFDGIPASPNLTPEFCSTQFDVFT
DRNRFREVGDFPQLNAALRIPMVLVMSIWADHYANMLWLDSVYPPEKEGEPGAARGPCAQ
DSGVPSEVKANYPNAKVVWSNIRFGPIGSTVNV
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgatgatgaagcagtatcttcagtacctggccgcaggttccctcatgaccggcctcgtc
gccggtcagggcgtcggcacccagcagaccgagactcacccccgaatcacctggaagagg
tgcacgggcaaggccaactgcacgacggtccaggctgaggtcgtcatcgactccaactgg
cgctggatccacacctcgggcggcaccaactgctacgatggcaacgcctggaacacagct
gcctgcagcaccgccaccgactgcgcgtcaaagtgcttgatggagggtgccggcaactac
cagcagacctacggtgcttccaccagcggtgactccctcactctcaagttcgtcaccaag
cacgagtatggcaccaacgtcggctctcgtttctacctcatgaacggtgcctccaagtac
cagatgttcaccctcatgaacaacgagttcacctttgacgtcgacctctccacggtcgag
tgcggtctcaattcggccctgtacttcgtcgccatggaggaggatggtggcatgcgcagc
tatcccaccaacaaggctggtgccaagtacggtactggttactgcgacgcccagtgcgct
cgtgatctcaagttcgtcggtggcaaggccaacattgagggctggcgcgagtcgtccaac
gatgagaacgctggtgtcggtccctatggcggttgctgcgccgagatcgatgtctgggag
tccaatgcccacgcctacgccttcaccccccacgcctgcgagaacaacaactaccacgtt
tgcgagcgtgacacctgcggtggtacctactccgaggaccgcttcgctggtggctgcgac
gccaacggctgcgactacaacccctaccgcatgggcaaccccgacttctacggcaagggc
aagaccgtcgacaccaccaagaagttcaccgttgtcacccgcttccaggatgacaacctt
gagcaattcttcgtccagaacggccaaaagatcctcgctcccgctcccacctttgacggc
atcccagccagccccaacctcacccctgagttctgctcgactcagtttgatgtcttcacg
gaccgcaaccgcttccgtgaggtcggtgacttcccccagctcaacgctgccctccgcatc
cccatggtcctcgtcatgtccatctgggccgatcactacgccaacatgctctggctcgac
tccgtctacccccctgagaaggagggcgagcccggtgctgcccgtggcccttgcgcccaa
gactctggtgttccctccgaggtcaaggccaactaccccaacgccaaggttgtctggtcc
aacatccgcttcggccccatcggctccaccgtcaatgtgtaa

DBGET integrated database retrieval system