KEGG   Podospora anserina: PODANSg4732
Entry
PODANSg4732       CDS       T01048                                 

Definition
(RefSeq) hypothetical protein
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
pan  Podospora anserina
Pathway
pan00100  Steroid biosynthesis
pan01100  Metabolic pathways
pan01110  Biosynthesis of secondary metabolites
Module
pan_M00102  Ergocalciferol biosynthesis, squalene 2,3-epoxide => ergosterol/ergocalciferol
Brite
KEGG Orthology (KO) [BR:pan00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    PODANSg4732
Enzymes [BR:pan01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     PODANSg4732
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295
Other DBs
NCBI-GeneID: 6192080
NCBI-ProteinID: XP_001907697
UniProt: B2AVE6
Position
7
AA seq 488 aa
MGSKAQQPIEASRKKPEYEFFGPPGAALISFVLPPLVYAITFACNDLSGCPAPSLLHPKN
LDLNVLKREVGWPQDGWPGLFSWEATGWTLAFYLFNAILYRILPATETEGTVLRSGGRLK
YRFNAFSTTMFCIVAAAAGTIAQGAEFPLWTYITDNYVQILTANTLIAYALATFVYVRSF
SVKPGNPENRELAAGGVTGNMIYDWYIGRELNPRVTLPFIGEIDIKEWMELRPGMLTYIL
LNGAFIAKQYRNYGYVTDSIVFVAVVQTLYVLDGQYMEPAIMTTMDITTDGFGFMLSFGD
LVWVPFIYTQQTRYLATHPQTLGPLGLAGVGALLVLGFAIFRLSNSQKNDFRTNPNDPKL
AHLKYMPTKAGTRLLISGWWGIARHINYFGDWLQAWPYSLPTGLAGYTILSAGSAAVDGA
TRMLDGRQVIPGEAKGWGIIFTYFYVLYFAILLIHRDRRDDEKCAKKYGEDWEKYKKTVR
WRIIPYIY
NT seq 1467 nt   +upstreamnt  +downstreamnt
atgggttccaaagcacagcaacccatcgaggcgtcgcgcaagaagcccgagtacgagttc
tttggaccacccggcgctgccctgatcagcttcgtcctcccacccctcgtctacgccatc
acctttgcgtgtaacgatctgtccggctgcccagcgccttccctcctccatcccaaaaac
ctcgatctcaatgtgttgaagcgcgaagttggttggccacaagatgggtggcctggtctc
ttcagttgggaggccacagggtggaccttggctttctacctcttcaacgccatcctgtac
agaatccttcccgcgaccgagaccgagggcacagttttgcgaagtggtggccggttgaag
tacagattcaatgccttctccaccaccatgttctgcatcgttgctgccgccgccggtacc
atcgcccagggcgccgagttccccctttggacctacatcaccgacaactatgtgcagatt
ctgactgccaacacactcattgcctatgcgctcgccacttttgtctacgttcgcagcttc
agcgtcaagcctggcaaccccgagaatcgcgagcttgctgccggtggcgttactggcaac
atgatatacgactggtacattgggcgcgagctcaacccacgcgtcaccctccccttcatt
ggcgagatcgacatcaaggagtggatggagttgcgccccggcatgctgacctacatcttg
ctgaacggggctttcattgcgaagcagtaccgcaactatggctatgtcaccgacagcatc
gtcttcgtggctgtcgtgcagacactttacgtcttggacggccagtacatggagcccgcc
atcatgacgactatggatatcaccaccgatgggtttgggttcatgctttcgtttggtgac
cttgtctgggttccattcatctacacccagcagacacgttaccttgccacccacccacag
acgctgggtcctttgggacttgccggtgtcggtgctttgttggtgctcggctttgccatc
ttccgcctgtccaacagccagaagaatgacttccgcaccaaccccaatgaccccaagctg
gctcatctcaagtatatgcccaccaaggcgggcactcgtctgctcatctctggctggtgg
ggcattgccagacacatcaactactttggtgactggcttcaggcttggccctacagtttg
cccaccgggcttgccggctacaccatcctgtctgcaggaagtgctgctgtggatggcgcg
accaggatgcttgacggccgccaggttatccccggtgaggccaaggggtggggcatcatc
ttcacctacttttacgtcttgtactttgccattctgttgatccaccgtgaccgcagagac
gacgagaagtgcgccaagaagtatggcgaggactgggagaagtacaagaagactgtcaga
tggaggatcattccttacatttactga

DBGET integrated database retrieval system