KEGG   Podospora anserina: PODANSg504Help
Entry
PODANSg504        CDS       T01048                                 

Definition
(RefSeq) hypothetical protein
  KO
K13179  ATP-dependent RNA helicase DDX18/HAS1 [EC:3.6.4.13]
Organism
pan  Podospora anserina
Brite
KEGG Orthology (KO) [BR:pan00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:pan03041]
    PODANSg504
   03009 Ribosome biogenesis [BR:pan03009]
    PODANSg504
Enzymes [BR:pan01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     PODANSg504
Spliceosome [BR:pan03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   RNA helicase-like proteins
    PODANSg504
Ribosome biogenesis [BR:pan03009]
 Eukaryotic type
  90S particles
   Helicases
    PODANSg504
  Pre-60S particles
    PODANSg504
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DEAD Helicase_C DUF4217 ResIII
Motif
Other DBs
NCBI-GeneID: 6187611
NCBI-ProteinID: XP_001903489
UniProt: B2ACU9
Position
3
AA seq 580 aa AA seqDB search
MASDPTSKKRKLKSEKTSVIKKVKKAKRDPTPEESEDAEIEDAPVAPESVADEEVEAAST
KDDSEDEDDDQNGSTDLAPPKADAPLIAPGLDTNATDFAQLNLSERTMKAIEEMGFTKMT
EIQRRGIPPLLAGKDVLGAAKTGSGKTLAFLIPAIEMLHSLRFKPRNGTGVIVVTPTREL
ALQIFGVARELMKHHSQTYGVCIGGANRRAEADKLGKGVNLLIATPGRLLDHLQNTPFVF
KNLKSLIIDEADRILEIGFEDEMRQIVKILPKDERQTMLFSATQTTKVEDLARISLRPGP
LYINVDEEKQYSTVEGVDQGYVIVDADKRFLLLFSFLKKMSKKKVIVFFSSCNSVKYYSE
LLQYIDLPVLDLHGKQKQQKRTNTFFEFCNATQGTLICTDVAARGLDIPAVDWIVQFDPP
DDPRDYIHRVGRTARGNNTKGRSLLFLQPCELGFLAHLKAAKVPVVEYDFPKNKILNVQS
QLEKLIGSNYYLNQSAKDGYRSYLHAYASHSLRSVFDIHKLDLVKVAKVSSCRDIFAPFG
SSFGFATPPRVDITLSASMSRDKKPQGRRPYGSQPKQERR
NT seq 1743 nt NT seq  +upstreamnt  +downstreamnt
atggcctccgatcccaccagcaagaagcgcaagctcaagtccgagaagacttcggtcatc
aagaaggtcaagaaagccaagagagacccgacccccgaggaaagcgaagatgctgagatc
gaggatgcccccgttgcgcccgagtctgttgcagacgaggaagtcgaggctgcttccacc
aaagacgactccgaggacgaggacgatgaccagaatggcagcaccgacctggcacccccc
aaggccgatgcacccctgattgcccccgggctcgacaccaacgcgaccgacttcgcccag
ctcaacctctccgaaaggacgatgaaggcgatcgaggagatgggtttcacaaagatgacc
gagattcagagacggggcatcccgccacttctcgccggcaaggatgttctgggagcggcc
aagacaggttccggaaagactcttgctttcttgattcccgccattgagatgctgcactcg
ttgcgcttcaagccaagaaacggaactggtgtcattgtggtgacccccactcgcgagctg
gccctgcagatctttggtgtcgcgcgcgagttgatgaagcaccactctcagacctatggt
gtgtgtattggtggcgcaaaccgcagggctgaggccgacaagctcggaaagggtgtcaat
ctgctcattgctacccccggtagactgctcgatcatctccagaacacccccttcgtcttc
aagaacctcaagtccctgattatcgacgaggccgaccgtattctcgagattggtttcgag
gatgaaatgcgccagattgtcaagattctccccaaggatgagcgccagactatgctcttc
tccgccacacaaacaaccaaggtcgaggatcttgccaggatatctctccggcccggaccc
ctctacatcaacgttgacgaggagaagcagtacagcacagtggagggcgtcgaccaaggc
tacgtcattgtcgatgccgacaagcgtttcctcctcttgttctctttcctcaagaagatg
tccaagaagaaggttatcgttttcttctcgtcttgcaactcggtcaagtactacagcgaa
cttttgcagtacattgacctgccggtccttgatctccacggcaagcagaagcagcagaag
cgcaccaacaccttctttgagttctgcaacgccacacagggtaccctgatctgcacggac
gttgctgctcgtggtctcgatatccccgctgttgactggatcgtccagttcgaccctcct
gatgatcctcgcgactacattcaccgtgtcggccgtacagcccgtggcaacaacaccaag
ggtcggtcgctcctcttcttgcagccctgcgagcttggtttcttggcccatctcaaggct
gccaaggtccccgtcgtcgagtacgatttccccaagaataagatcctcaacgtgcagtct
cagctggagaagctcattggcagcaactactacctcaaccagagcgccaaggacggttac
cggtcgtatctccatgcttatgcctcgcacagtctgcgcagtgtatttgacatccacaag
ttggatctcgtcaaggtggccaaggtaagttcttgtcgtgacattttcgcgccctttggg
tcaagcttcggttttgctacgccaccaagggttgacattactctctcagccagcatgagc
agggataagaagccacaagggagaaggccgtacggcagccaacctaagcaggagcggagg
taa

DBGET integrated database retrieval system