KEGG   Podospora anserina: PODANSg5971Help
Entry
PODANSg5971       CDS       T01048                                 

Definition
(RefSeq) hypothetical protein
  KO
K01899  succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5]
Organism
pan  Podospora anserina
Pathway
pan00020  Citrate cycle (TCA cycle)
pan00640  Propanoate metabolism
pan01100  Metabolic pathways
pan01110  Biosynthesis of secondary metabolites
pan01130  Biosynthesis of antibiotics
pan01200  Carbon metabolism
Module
pan_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pan_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pan00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PODANSg5971
   00640 Propanoate metabolism
    PODANSg5971
Enzymes [BR:pan01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     PODANSg5971
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     PODANSg5971
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ligase_CoA CoA_binding Succ_CoA_lig
Motif
Other DBs
NCBI-GeneID: 6193249
NCBI-ProteinID: XP_001908936
UniProt: B2AYY5
Position
1
AA seq 634 aa AA seqDB search
MFQGFTGKQATANAKDSIAWGTNIVGGVRPGRTGEHLGLPVLPTVQSVYATAIYVAAHQA
PGAIEEAIEAEVPLIVAVAEHIPLHDMLRIHSILKTQSKSRLVGPNSPGIISAVGKCRIG
FQPLPCFSPGKIGIIAKSGTLSYETVASTTRAGLGQSLCIGVGGDIVPGTDLREAFTVLE
NDSDTEAIAVIGEIGGLGELDAAEWYYSDLLSFSHTNSKLNHRPIVGLIAGIHEPRGRIM
GHAGAFTIAGEPDAKEKIEALVSAGVTMVTHPGQFGEAFKARLGGSTHGVNSPAGRGKLG
NQRRQIHTAVRRPQTRTRFLAKPCTQQRRHLTLSEDDCMDLLREAGLNCGHYSGLGTRRF
LAIGVDRSTRSPCILAAPTVDDDQIEKMVKRYSFDYRHGPDELAIERVASRLHISLKESA
HESLRRLVHRLSDIFYEKEAYLMETEIVERLGEIKVVGARFGFDDAAYRSCGRQTELQKL
RNTAVEDASELEAEKSGIIYIKLEGNGTIGTLVNGAGLAMNTVDALGGHATNFLDTGGKA
TSETVKHGFEVILKDPRVRVIFVNIFGGLTLGDMIANGIIMAFKELSPRVPVVVRIRGTN
EKEGQKLIEESGLPLYAFDDFEAAKAKAIELSSA
NT seq 1905 nt NT seq  +upstreamnt  +downstreamnt
atgttccaaggcttcacgggcaagcaggcaacagcaaatgccaaagactcgatcgcttgg
gggaccaacattgttggaggcgtgaggcccggccggaccggagaacatctcgggcttccg
gtgctccccacggttcagtcagtctatgcaacagcgatctatgtagcagctcatcaggcc
ccaggtgctatcgaggaggccattgaagccgaggttcctttgatcgtggcagtagcagag
catattcctctgcacgacatgcttcgaattcattctatcttaaagactcaatccaagtct
cgcctggtcggtccaaactccccagggatcatctccgccgtgggaaagtgtcgaatcgga
ttccagcccttgccttgcttctcgccagggaagattggaatcattgctaaatcaggtacg
ctgagctatgaaactgtggcgtcaaccacgagagctggtcttgggcagagcctttgtata
ggcgtgggcggtgacattgttcccggtacagacctgagggaggctttcactgtcttagaa
aatgacagtgatacggaggctattgctgtaatcggggaaatcggcggtttgggtgagctg
gatgctgccgaatggtattattccgacttactatcattctcgcacacaaactccaaactc
aaccataggccaatagtcgggcttatcgctgggattcacgagccacgcggtcgtatcatg
ggtcatgccggagctttcactatcgctggggaacctgatgcgaaggagaagatagaagcg
ctggtgtctgctggtgtgacaatggtgacacacccaggtcagtttggtgaagctttcaag
gcaagattgggagggtctacacacggggtgaactccccagctggtcgcggcaaattggga
aaccagcgtagacagatccacacggctgtccgtagacctcaaacgaggactcggtttcta
gcaaagccgtgcacacagcaacggcgccacctgacattgtccgaggacgactgtatggat
ctgctgcgcgaagcaggccttaactgcggccattactcggggctaggcactaggcgcttc
ttagccataggggtcgatcgttcgaccagatcaccgtgtattcttgcggctcctaccgtg
gatgacgatcagatcgagaagatggtaaaacgttactccttcgactatcgccacggtcca
gacgagcttgccattgagcgtgttgccagtcgcctgcacatcagtctcaaggaaagtgcc
catgaatctctccgccgtcttgtccacagactatcagacatattttacgaaaaggaggca
tatctgatggagacagagattgtggaacgtcttggtgagatcaaggtggttggtgctcgc
ttcggctttgacgacgcagcctatcgaagctgcggacggcagaccgagttgcagaaattg
agaaacacagccgtggaggatgcctctgagctcgaggcggaaaagagtggcattatatac
atcaaattggagggtaacgggaccatcggaaccttggtcaatggcgcagggctcgccatg
aacacggtcgatgccctggggggccacgcaactaattttctcgatactggcgggaaagca
actagcgagacggtcaagcacggcttcgaggttatcttgaaagatccaagggtccgggtg
atatttgtgaatatttttggcgggctgactttgggggacatgatcgccaacggcatcata
atggctttcaaggagctctcgccacgcgtgcccgtcgtggtacggattcgagggaccaac
gagaaggagggacagaaactcatcgaggaaagtggcctcccgctttacgcctttgacgat
ttcgaggcggctaaggcgaaggcgatagagctatcaagtgcttag

DBGET integrated database retrieval system