KEGG   Podospora anserina: PODANSg6300Help
Entry
PODANSg6300       CDS       T01048                                 

Definition
(RefSeq) hypothetical protein
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
pan  Podospora anserina
Pathway
pan00564  Glycerophospholipid metabolism
pan00565  Ether lipid metabolism
pan00590  Arachidonic acid metabolism
pan00591  Linoleic acid metabolism
pan00592  alpha-Linolenic acid metabolism
pan01100  Metabolic pathways
pan01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pan00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    PODANSg6300
   00565 Ether lipid metabolism
    PODANSg6300
   00590 Arachidonic acid metabolism
    PODANSg6300
   00591 Linoleic acid metabolism
    PODANSg6300
   00592 alpha-Linolenic acid metabolism
    PODANSg6300
Enzymes [BR:pan01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     PODANSg6300
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLA2_B Con-6 Guanylate_kin
Motif
Other DBs
NCBI-GeneID: 6193915
NCBI-ProteinID: XP_001909265
UniProt: B2AZK9
Position
3
AA seq 831 aa AA seqDB search
MIPPRSVLHRCLTGITRRRPLFSVTTTTRSPRRAPFNGRHGFFTSSRQGAEQKGSSKVGI
TRTVGLSTTCALLALWLYPHESLTQLTKPLGLVADERRMSPDGVEIKVIKSTEKGRQKEK
REEESVWAGIAKGLEGFPSIPGPPENITDMVVDFILPEWTKSLPGLMRKLQRELEMAPGS
LAAEIWDEARDPFTHPEIEWEAKVRVSNALCEEEKTFLERRKKVIVPALAKYLGLKEEDI
HPDDVPTVAICGSGGGLRALVAGTGSFLASTEDGLFDCVTYASGVSGSCWLQSLYYSSVT
GNSFQRAIDHLKARLGTHIADPPVAFNSLTSAPTNKYLLSGIVEKFKGDSAASFSLVDVY
GILLAARLLVPKGELEVNEKDFKLSSQREYVRYGQNPLPIYTAVRHEIPEMDEQDADGNP
PVSEEAKERAKKEAWFQWFEITPYELFCEEFSAGIPTWALGRKFKNGSDTGLRLPEVRMP
LLLGIWGSAFCATLSHYYREIRPIIRSIVGFGPIDGLIWNNLNEDLSKVHPIDPASMPNF
VYGMHGKLPSTVPETVYDNENIQLMDAGMSNNLPIYPLLRPGRDVDIIISFDASADIKTD
NWLSVVEGYAMQRGIKGWPLGIGWPKPEASAKETAKQLDKAESASSPSESQDRVADAKME
QAARQQQMQEDDSSKKTEAEKHQQASDELGYCTVWVGTTQERSSAPPPPPKPIDDESSWR
LMEPDAGIAVVYMPFLANEKKVPGVDPAGSEYMSTWNFVYSPEDVEGVVRLARANYEEGR
GQIKATVRAVYERKKRRREEHARRVKEEAWRRVIRGGRAGKVGVEGGDQFS
NT seq 2496 nt NT seq  +upstreamnt  +downstreamnt
atgataccgccacgctcggtactacacagatgccttacggggatcacaaggcggcgaccg
ctattcagcgttacgacgacgacaagatcacccaggagagcaccgttcaacggccgtcat
ggcttctttacaagctcacgacagggggcggaacaaaaggggtcgtcaaaagtgggcatc
acccgaaccgttggtttatcgacgacttgcgctttgcttgctctttggctctatccgcac
gaatcactgacgcagcttacgaagcctttgggcttagttgccgacgaaaggagaatgtcg
cctgatggcgtggagatcaaggttatcaagagcaccgagaagggtcggcaaaaggagaag
cgggaagaagagagcgtttgggctgggattgccaaaggcttggaaggatttccttcgatc
ccggggccgcccgagaatataactgatatggttgtcgactttattttgcccgagtggacc
aagagtttgcctgggttgatgaggaagttgcagcgggagttggagatggcaccggggtcg
ttggcggcggagatttgggacgaggcaagggatccgtttacgcaccccgagattgagtgg
gaggctaaagtgagagtgtcgaatgcgctctgtgaggaggaaaagactttcttggagagg
cggaagaaggttattgtgcctgcactggcaaaatacttggggttgaaagaggaggatatc
caccccgatgatgtccccactgtggccatttgcggctcaggaggaggtttgagagcgttg
gttgctggaactgggtctttcctggcgtccaccgaggacggcttgttcgactgtgtaacg
tatgcttcgggcgtgtctgggtcgtgctggcttcagtccctctactattcctcagtcacg
ggcaacagctttcagcgagcgatcgaccatctcaaagcacgcctcggcacccatattgct
gaccccccggtggctttcaactcgttgacttcggcgccgacgaacaaatatctgctgagc
gggattgtggaaaagttcaagggggactcagcagcgtctttcagtcttgtcgatgtctat
ggtatactgttggcggcgaggctgcttgttcccaagggcgagctggaggtcaatgagaaa
gacttcaagctgtccagccagcgggaatacgtcagatacggccagaacccactacccatc
tacaccgccgttcgtcacgagattccagaaatggacgaacaagacgccgacgggaacccg
cccgtttcagaagaggccaaagaacgcgcaaagaaggaagcctggtttcagtggttcgag
ataacaccctacgaactattctgcgaggagttttccgctggtattcccacctgggcactc
ggccgcaagttcaaaaacggctctgacactggtctccgtctgcctgaagtccgtatgcct
ctcctcctcggcatctggggcagcgccttttgcgcgactctcagccactactaccgtgaa
atccgccccatcatccgcagcatcgtcggttttggccccatcgacggacttatctggaac
aacctcaacgaggatcttagtaaggtccatcctatcgaccctgcctcgatgccgaatttt
gtgtatggcatgcacggcaagttaccgtccaccgttcccgaaaccgtctacgacaatgaa
aacatccaacttatggacgcgggcatgtcgaacaacctgcccatttatccgctgttgcgc
ccggggagggatgtagacatcatcatctcttttgatgcatcagcagacattaagacagac
aactggctctcggtggtggaagggtacgccatgcagcgcgggatcaaagggtggccgttg
gggattgggtggcccaagccggaagcgtcggcgaaggaaacagcgaagcagctcgacaag
gcggagagtgcctcttcgccgtctgaatctcaagatcgcgtcgcggacgcgaagatggag
caggcagcccgtcaacagcagatgcaagaggatgacagttccaaaaagaccgaagcggaa
aaacatcagcaggcttcggacgagttggggtactgcacggtttgggttgggaccacgcag
gagaggagtagtgctccgccgccgccgccaaagccgattgatgatgaaagtagctggaga
cttatggagccggacgcggggatagcggttgtttacatgccgtttttggcgaacgagaag
aaggttcccggggtagatccggcggggagtgagtacatgagcacgtggaattttgtgtat
agtccggaggatgtggagggggtggtgaggttggcgagggcgaattatgaggaggggagg
gggcagatcaaagcgacggtgagggctgtttatgagaggaagaagaggaggagggaggag
catgccaggagggtgaaggaggaggcgtggaggagggtgataagggggggccgggctggg
aaggttggggtggaggggggggatcagtttagttag

DBGET integrated database retrieval system