KEGG   Podospora anserina: PODANSg6609Help
Entry
PODANSg6609       CDS       T01048                                 

Definition
(RefSeq) hypothetical protein
  KO
K01900  succinyl-CoA synthetase beta subunit [EC:6.2.1.4 6.2.1.5]
Organism
pan  Podospora anserina
Pathway
pan00020  Citrate cycle (TCA cycle)
pan00640  Propanoate metabolism
pan01100  Metabolic pathways
pan01110  Biosynthesis of secondary metabolites
pan01130  Biosynthesis of antibiotics
pan01200  Carbon metabolism
Module
pan_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pan_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pan00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PODANSg6609
   00640 Propanoate metabolism
    PODANSg6609
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pan04147]
    PODANSg6609
Enzymes [BR:pan01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     PODANSg6609
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     PODANSg6609
Exosome [BR:pan04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PODANSg6609
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A PuR_N
Motif
Other DBs
NCBI-GeneID: 6193628
NCBI-ProteinID: XP_001909573
UniProt: B2B0Y1
Position
3
AA seq 446 aa AA seqDB search
MFRLGRNRALASAFAAPKTSPAPRLPSFAQQQRRALSIHEYISADLLKQYGIDVPKGAVA
KSAAEAEAVAKSIGSDDMVIKAQVLAGGRGKGTFDNGLKGGVRVIYSPTEAKMFAEQMIG
HKLITKQTGAQGRLCNSVYICERKFARREFYLAVLMDRGSQGPVIVSSSQGGMDIEGVAK
ENPDAINTTYIDINVGVTDEMARDIAVKLGFSEQCVDDAVKTIQNLYKIFLEKDATQIEI
NPLSETSDHKVMCMDAKFNFDDNAEFRQKEAFEWRDTTQEDADEVRAAESGLNFIKLDGD
IGCLVNGAGLAMATMDIIKLNGGQPANFLDVGGGATPAAIKEAFELITSDPKVTAIFVNI
FGGIVRCDAIAHGLINTVKSLDLKIPIIARLQGTNMEEAHRLINDSGMKIFSIDDLQNAA
EKAVQLSKVVKMARDIDVGVEFTLGI
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atgttcagactcggtcgcaaccgcgcattggcctcggcctttgctgcccccaagacttcc
cccgcccccagacttcccagcttcgctcaacaacaaaggagagcgctcagcatccacgaa
tacatctcggccgacctcctcaaacagtatggcatcgatgtccccaagggcgccgtcgcc
aagtctgccgccgaggctgaggctgtcgcgaagtcgatcggcagcgacgacatggtcatc
aaggcccaggtcctcgccggtggtcgtggcaagggtacctttgataacggcctgaagggc
ggtgttcgtgtcatctactcccccaccgaggccaagatgttcgccgagcagatgatcggt
cacaagctcatcaccaagcagaccggtgctcagggccgtctctgcaactccgtctacatc
tgcgagcgcaagttcgcccgccgcgagttctacctcgccgtcctcatggaccgtggctcc
cagggccccgtcatcgtgtcctcgtcgcagggcggcatggacattgagggtgtcgccaag
gagaaccccgatgctatcaacaccacctacatcgacatcaacgtcggtgtgacggacgag
atggcccgcgacatcgccgtcaagctcggcttcagcgagcagtgcgttgacgatgccgtc
aagaccatccagaacctctacaagatcttcctcgagaaggacgccacccagatcgagatc
aaccccctctccgagacttcggaccacaaggtcatgtgcatggacgccaagttcaacttt
gacgacaacgccgagttccgccagaaggaggccttcgagtggcgcgacaccacccaggag
gacgccgatgaggtgcgcgccgccgagtccggtctcaacttcatcaagctcgacggtgac
atcggctgccttgtcaacggcgccggccttgccatggccaccatggatatcatcaagctc
aatggcggccagcccgccaacttcctcgacgtcggtggtggtgctacccccgccgccatc
aaggaggctttcgagctcatcaccagcgaccccaaggtcactgccattttcgtcaacatc
tttggcggtatcgtccgctgcgacgccattgctcacggtctgatcaacactgtcaagtcg
ctcgacctcaagatccccatcattgcccgtctgcagggtaccaacatggaggaggcccac
cgtctgatcaacgactcgggcatgaagattttctctatcgatgacttgcagaacgctgcc
gagaaggcggtgcagctcagcaaggttgtcaagatggctcgtgacatcgatgtcggcgtt
gagttcactcttggtatctaa

DBGET integrated database retrieval system