KEGG   Podospora anserina: PODANSg7028Help
Entry
PODANSg7028       CDS       T01048                                 

Definition
(RefSeq) hypothetical protein
  KO
K14565  nucleolar protein 58
Organism
pan  Podospora anserina
Pathway
pan03008  Ribosome biogenesis in eukaryotes
Brite
KEGG Orthology (KO) [BR:pan00001]
 09120 Genetic Information Processing
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    PODANSg7028
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:pan03009]
    PODANSg7028
Ribosome biogenesis [BR:pan03009]
 Eukaryotic type
  Sno RNPs
   Box C/D snoRNPs
    PODANSg7028
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Nop NOP5NT
Motif
Other DBs
NCBI-GeneID: 6194479
NCBI-ProteinID: XP_001909991
UniProt: B2B1Z0
Position
6
AA seq 546 aa AA seqDB search
MGLFILTETSAGYGLFKASDKKLLEDDNLTDRLSTTEKIVKEIKYKEFAKFDSAASALEE
ISGLVEGKVTPRLQNLLNEFKDEKKVTLAVAESKLGASIKKLPELNIKPISDSTTNELFR
AIRQHLPELVPGMLPENFKEMSLGLAHSLSRHKLKFSPEKVDIMIVHAVSLLDDLDKELN
TYAMRVKEWYGWHFPELAKILPDNLSYAKIIVTLGVRTNAPETDLSEILPHEIEAAVKSA
ADISMGTEINEEDLNNIKLLAERVIALSEYRKQLSEYLENRMKAISPNMTELLGALVGAR
LIAHAGSLISLAKNPGSTIQILGAEKALFRALKTKHATPKYGLIYHASLVGQASGNNKGK
IARQLAAKVALGVRTDALSEFDEDVDDETRAELGIKSRAKLENSLRLMEGKPISTKLGPN
PNNITVPKWDIKEARKYNADADGVAAEAETAKPLIEEVEMEDAPADEEKASKKEKKEKKE
KKENKEKKDKSEKKDKKEKKKSKEPTEETESPAKTKSSKRKHDDDEEAAPVKEKEHKKKK
KKHSKE
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atgggtcttttcattcttaccgaaaccagcgccggttatggcctgttcaaggcttccgac
aagaagctcttggaggacgacaacctgaccgaccgtctttccaccactgagaaaatcgtc
aaggagatcaagtacaaggagtttgccaaattcgacagcgccgcctcggctctcgaggaa
atctcgggcctcgtagaaggcaaggtcacaccacgcctccagaacctcctcaacgagttc
aaggatgagaagaaggtcacccttgccgttgccgagagcaagcttggcgcctccatcaag
aagctgcctgagctcaacatcaagcccatctccgatagcaccacgaatgagctcttccgc
gccatcagacaacatcttcccgagcttgtccccggcatgctccctgaaaacttcaaggag
atgtctctgggtctggcccactccctctcccgccacaagctcaagttctctcccgagaag
gtcgacatcatgattgtccacgccgtttccctccttgacgatttggacaaggagctcaac
acctatgccatgcgcgtcaaggaatggtacggctggcacttccccgagttggccaagatt
ttgcccgacaacctctcttatgccaagattatcgttactctgggtgtccgcaccaacgct
cctgagaccgacctttccgaaattctccctcacgaaatcgaggctgccgtcaagtctgcc
gctgatatttccatgggtaccgagatcaacgaggaggatctcaacaacatcaagcttctc
gctgaacgtgtcattgctctttccgagtaccgcaagcagctttccgagtacctcgagaac
cgcatgaaggccatctcccccaacatgaccgagcttctcggcgcccttgttggtgctcgt
cttattgcccacgctggttccctcatcagcttggccaagaaccccggttctaccatccag
attctcggtgccgaaaaggctcttttccgtgccctcaagaccaagcacgcgacccccaag
tatggtctcatctaccacgcctccctcgttggccaggcttctggtaacaacaagggtaag
attgcccgtcagctcgccgccaaggtcgcccttggtgtgcgcactgatgctctttccgag
ttcgacgaggatgtcgatgatgagactcgcgccgagctcggcatcaagtctcgcgccaag
ctcgagaacagcctgcgcttgatggagggtaagcccatctccaccaagctcggccccaac
cccaacaacatcactgtccccaagtgggacatcaaggaggcccgcaagtacaacgccgat
gccgacggtgtcgccgctgaggccgagactgccaagcccctcattgaggaggtcgagatg
gaggacgcgcctgccgatgaggagaaggccagcaagaaggagaagaaggagaagaaggag
aagaaggaaaataaggagaagaaggacaagagcgagaagaaggacaagaaggagaagaag
aagtccaaggagccaacagaagagaccgaaagcccagccaagaccaagagctccaagcgc
aagcacgatgatgacgaggaggcggcgccagtaaaggagaaggagcacaagaagaagaag
aagaagcacagcaaggagtaa

DBGET integrated database retrieval system