KEGG   Podospora anserina: PODANSg7616Help
Entry
PODANSg7616       CDS       T01048                                 

Definition
(RefSeq) hypothetical protein
  KO
K05972  acetylxylan esterase [EC:3.1.1.72]
Organism
pan  Podospora anserina
Brite
KEGG Orthology (KO) [BR:pan00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    PODANSg7616
Enzymes [BR:pan01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.72  acetylxylan esterase
     PODANSg7616
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Esterase_phd Peptidase_S9 Esterase Abhydrolase_3
Motif
Other DBs
NCBI-GeneID: 6194683
NCBI-ProteinID: XP_001910577
UniProt: B2B3M7
Position
6
AA seq 321 aa AA seqDB search
MLFKSLVLLAGTAAVAHGAPSAPGANDIPRDVLTQISSWGSNPTNLQLHLYAPSNLTGKP
AIILALHGCFGSGPGHAEMTSQFQTLSSSRNFVVLYPSSINDNNCWDVASPASLTRDGGG
DSTGLATIVRWATTTFNADPKKVFITGSSSGCMMSNVMASAYPDLFSAVSCYSGVPAGCL
AGSPGSSPISADQTCANGGIRKTGEEWAEVVRGMAPLPEGKGKGKGKGKGKGNQGWKYPK
VATWHGDNDFFVNYFHNFEEQLKQWGAIHGVEFTRNETNVPAAGYTKMVYGDGTKLVGYS
ASGVGHVVPQFEAVDLEWFGL
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgttgttcaagtcccttgtcctcctcgctggtaccgctgccgtggcccacggtgctccc
tccgctcctggtgctaatgacatcccccgtgatgtcctcactcagatctcgtcgtgggga
tccaaccccaccaacctccaacttcacctctatgccccctccaacttgaccggcaagcca
gccatcatcctcgctctccacggctgcttcggctccggccccgggcacgccgaaatgact
tcccaattccaaaccctctcctcctcccgcaacttcgtcgtcctctacccatcctccata
aacgacaataactgctgggacgtcgcctcccccgcctccctcacccgcgacggaggaggt
gattccaccggcctagccaccatcgtccgctgggccaccaccactttcaacgccgacccc
aagaaggtcttcatcaccgggtcatcctcaggttgcatgatgtccaacgtcatggcctcg
gcctatcccgacctcttctccgccgtgtcctgctacagcggcgtcccagccggctgtctc
gctggctcccctggcagcagccccatcagcgccgatcagacgtgcgccaacggggggatt
agaaagacgggggaggaatgggctgaggtggtgagggggatggcgcctttgcctgagggc
aagggcaaggggaagggcaagggtaaagggaaggggaaccaggggtggaagtatcccaag
gttgctacctggcatggggataatgactttttcgtgaactatttccacaactttgaggag
cagcttaagcagtggggggcgattcacggggtggagtttaccaggaatgagacgaatgtt
ccggcggcgggctacaccaagatggtgtatggggatgggacgaagctggtgggatattcg
gctagtggggtggggcatgtggtgccgcagtttgaggcggttgatctggagtggtttgga
ctttga

DBGET integrated database retrieval system