KEGG   Podospora anserina: PODANSg8398Help
Entry
PODANSg8398       CDS       T01048                                 

Definition
(RefSeq) hypothetical protein
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
pan  Podospora anserina
Pathway
pan00450  Selenocompound metabolism
pan00970  Aminoacyl-tRNA biosynthesis
pan01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pan00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    PODANSg8398
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    PODANSg8398
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:pan01007]
    PODANSg8398
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:pan03016]
    PODANSg8398
Enzymes [BR:pan01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     PODANSg8398
Amino acid related enzymes [BR:pan01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   PODANSg8398
Transfer RNA biogenesis [BR:pan03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    PODANSg8398
 Prokaryotic type
   Other AARSs
    PODANSg8398
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1 tRNA-synt_1f
Motif
Other DBs
NCBI-GeneID: 6195428
NCBI-ProteinID: XP_001911356
UniProt: B2B5V6
Position
2
AA seq 637 aa AA seqDB search
MDQLVKSSPMEFLKAASLRRLPTSKWSLTTRRQTWTCTSCLSSSSSSPRRFTTSLPRLSS
TTDLPTKPYYVTTPIFYVNAAPHIGHMYSMTLADVLKRYQSVLHSRPAILLTGTDEHGMK
IQQAASNKDMHPKQFCDETAEQFKELASTAQISYNRFIRTTDTDHIQAVEHFWFLLQEKG
LIYESKHEGWYSVSDEAFYPESQIEKKMDAFTGEVFMASVESGSKVEWVEERNYHFRMTA
LRERLLGFYGENPEWVVPAKRMGDVVDWVRNHLTDLSISRPASRLSWGVRVPGDASQTIY
VWVDALINYITAAGFPNWQPGRREVGGWPADVHVIGKDIVRFHCVYWPALLLALDLPMPK
KVLTHAHWTMNRTKMSKSLGNVVNPMYVMNVHGADVLRFYLMFEGGIGNDADYNNDNLLV
KHKKYLQGGVGNLVSRITRSKLWDLKEIISRSPRGRIEFPEDNLATLPAIVDKHMENLDP
VSALRAIMEVATQANALLSEIEPWRLKKSTNQEDHDLADEMVCLAAESLRVCGILLQPFL
PTKADQLLDMLGVLPENRTFKNTELFSDTSYGVPIANPGKGREDSLFPALYQGLQAAEEK
LRTVKKERKEAKKRQRKAQRGKEVDEWWKPEASGEQS
NT seq 1914 nt NT seq  +upstreamnt  +downstreamnt
atggaccaattggtcaaatcatcaccaatggagttcctaaaagctgcctccctccggcgc
ctaccgacttcaaaatggtcactcaccacccgccgccagacctggacatgtacctcctgc
ctctcctcctcctcctcctctcctcgaagattcaccacctccctcccccgactctcctct
accaccgacttgcccaccaaaccctactatgtcaccacccccatcttctacgtcaacgcc
gccccccacatcggccacatgtactccatgaccctcgccgacgtcctcaaacgctaccaa
tccgtcctccactcccgtcccgcgatcctcctcacaggaacagacgaacacggcatgaaa
atccagcaagcggcctccaacaaagacatgcaccccaagcaattctgcgacgaaaccgcc
gaacagttcaaagagctggcctctacagcccagatatcgtacaaccgcttcatccgcacc
accgacaccgaccacatccaagcggtggaacatttctggtttttgctgcaagaaaagggg
ttgatatacgagagtaaacacgagggatggtattccgttagtgacgaggcgttttatcca
gaaagtcagatcgagaagaagatggatgctttcacgggggaggttttcatggccagtgtc
gagagcgggagtaaggttgagtgggtggaggagaggaattaccacttcaggatgacggct
ttacgggagaggttgctggggttttatggggagaatccggagtgggtggtgccggcgaag
aggatgggggatgtggtggattgggttaggaatcatttgacggatttgtcgatttcgaga
ccggcgagtaggttgagctggggggtgagggtgccgggggatgcgagccagacgatatac
gtctgggtggatgctttgattaattacatcactgcggcggggttcccgaactggcagccg
ggaaggagggaggtgggtgggtggccggcggatgtgcatgtcattgggaaggatattgtt
aggtttcactgtgtgtattggccggcgttgttgttggcgttggatttgccgatgccgaag
aaggtgctcacgcacgctcactggacgatgaacaggacgaagatgagtaagagtttgggg
aatgtggtcaatccgatgtatgtcatgaatgtgcacggggcggatgtgttgaggttttac
ctcatgttcgagggggggattgggaatgatgcggattataacaatgataacttgctggtg
aagcacaagaagtatttgcagggaggggtggggaatttggtgtcgaggataacgaggtcg
aagctttgggatctgaaggagattatttcgagatcgccgagggggaggatagagttcccg
gaggacaacttggcgacgctcccggcgattgtggacaagcacatggagaatctggatcct
gtctctgctctgcgggccatcatggaggtcgcaactcaggccaacgcccttctctcggaa
atagaaccctggaggttaaaaaagagcaccaaccaagaagatcatgatctcgccgacgaa
atggtctgcctcgcagcagagagcctgcgggtttgcggtattctcctacagcccttcctc
cctaccaaagcagaccaactcctcgacatgctcggggtgttgccagaaaacaggacattc
aaaaacaccgagctcttctcagacactagctacggagtgccaatagccaaccccggcaag
ggaagggaagacagtctattccctgcgttataccaaggcctacaagcagccgaggagaag
ctaaggactgtcaagaaggagagaaaggaagcaaagaagcggcagaggaaggcacagaga
gggaaagaggtcgacgagtggtggaaaccggaggctagtggtgagcagtcatga

DBGET integrated database retrieval system