KEGG   Podospora anserina: PODANSg8570Help
Entry
PODANSg8570       CDS       T01048                                 

Definition
(RefSeq) hypothetical protein
  KO
K15316  noranthrone synthase [EC:2.3.1.221]
Organism
pan  Podospora anserina
Pathway
pan00254  Aflatoxin biosynthesis
pan01100  Metabolic pathways
pan01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pan00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    PODANSg8570
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:pan01008]
    PODANSg8570
Enzymes [BR:pan01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.221  noranthrone synthase
     PODANSg8570
Polyketide biosynthesis proteins [BR:pan01008]
 Polyketide synthase (PKS)
  Iterative type I PKS
   Fungal nonreducing PKS (NR-PKS)
    PODANSg8570
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ketoacyl-synt SAT Acyl_transf_1 Thioesterase Ketoacyl-synt_C PP-binding PS-DH KAsynt_C_assoc Abhydrolase_6 Thiolase_N
Motif
Other DBs
NCBI-GeneID: 6195862
NCBI-ProteinID: XP_001911528
UniProt: B2B6C8
Position
2
AA seq 2263 aa AA seqDB search
MSLFSLSCFPVPITMWSPSSHHHTPSTAFHTPAMANNTSIFLFGDQTFDFVPKLRELLTV
QDCPLLAAFLGQAHYVVRAQMIRSLPPQEHKLSRTANLAEMLQKYADGKLNPAFQTALSC
ISQLGSFMQTYEEDSTKPYPRANDSYVLGVCTGSLAAAAISCSSSLSELLPIAVQTALIA
FRLGLCALEMRDSLETSAPDRARPWSVVVSGLMPQVAEAFVKEFCDGNALPKTRYPWITA
TAAKSTTITGSPRVLDQLLAAKSFNGYKTTEIPVFVPSHGDHLFTSKDIDFILETTAVAP
WSGYSAKIPFLSSASGKLVWVANFRALVELALSQCLLVPIGWDKVETEVPRLLKSRGVSS
AVIAPVGSSAQKSLSSALATGGIANEIGTVTGGTNRFSHRPGSNRCKLAIVSMSGRFPEA
QSTDAFWDLLYKGVDTCKEVPRRRWDVRTHVDDTGKARNKGATRWGCWLDFTAEFDPRFF
SISPKEAPQMDPAQRMSLMSTYEAMERAGIVPDTTPSTQRNRIGVFHGVTSNDWMETNTA
QNIDTHFITGGNRGFIPGRINFCFEFSGPSYSNDTACSSSLAAIHLACNSLWRGDCDTAV
AGGTNMIFTPDGHTGLDKGFFLSRTGNCKPFDDAADGYCRAEGVGTVFIKRLEDALADND
PILATILDAKTNHSAMSDSMTRPHVGAQIENMTAVLSSACVGPNELSYIEMHGTGTQVGD
AVEMESVLSVFAPDEEARPKNRPLYVGSAKANVGHGEGVSGVTSLVKVLLMMQHNTIVPH
CGIKPGSKINRHYPDLGARNVHIALEPKPWPRSNGPRRVLINNFSAAGGNTALLVEDAPE
RQDLSAPDPRTNHIVTASGHVGKSLKTNLERLLEHIQSTPNLSISQLSYTTTARRWHHLH
RVSITGSTITEVERSLITAIANGDGINRPKTKPNVVFAFTGQGSQYLGMGRQLYEAYPVF
RDAVDRFDRLAQSHGFPSFLHIITSAEGDMDAMLPVVVQVGLTCLEMALGDLLRSFGLRP
SVVVGHSLGEYAALYVAGVLSASDAIYVVGKRAELLQERCQRGTHSMLAARASAASLTET
LEGLSCDVACINGPHDTVVSGSIEDITEAQRVLAGKGIKATVLKLPFAFHSAQVQPILED
FEKLAGGVSFSKPVVPVLSPLLGNIINEEGAIGANYLARHCREAVDMVKALETARDKGLI
NDKTIIVELGPKPLLSGMVKMTLGNNMTTLSTLHQNTDVWPNLTTILSTIYTAGLDVNWV
AYHAPFDSAKKVIPLPDYGWDLKEYYIPYEGDWCLHRHEIKCDCADAGKEVHTSAYQVPT
ESPLRKPSKLDATKEAYPEIKTTTTVHRVVEEKTEPLGATFIVETDMSRADVNPIAQGHL
VDGIPLATPSFYADIALQVGRYSMARLRAGHPGALDGLVDVCDLVVDKALIPHGQGPQLL
RTTLTMSWPPKAAATTRKATVKFATYLPDGKLDTEHATCRVRFTTDAQHKSLQKKVPDYK
AKIHQLHDGMAKGRCLRYTRKSGYKLMSSMATFHPDYKLLDNLILNEAENEATCKMNFSD
AKSEGDFAAHPAYVDAITQVAGFAMNASDETDIAKEVYVNHGWGSLQIYEPLVKGKEYEV
YTKFSRDKGGDLAHGDVVVLHGDKVVAFFGNLSLRNVPRKALHVVLKSALDKGIRQRGGN
PTAPAKSKPSFVDVKPTPAPMTTKQATQPASASDPVKKRTAPKPKAKTCGTPNDEKFHAV
LRVVSEESGVALEELTDESNFVDMGIDSLSSMVIGSRMREDLGMDMASEFSLFIDCPTVG
ALRNYLGASSTAAEVEDDEDDEYHDAEPVASQQTQDPYFAHVTTRASDVLATPTTESGAA
FDSSQFPAALKIISEESGVAIEELTTETIFSDIGIDSLSSMVISSRFKEELGLGLDSAFS
LFDDVPTVAKLSAFLNNNNNNNNNSSSNLAPEEVASISSTTSDLDHSSSIHESSSSSASE
PEDDDNDYPPSIKRVPHCRPCTSVILQSLPRVAKRTLFLLPDGGGSASSYVPLPRLKSDV
AVVGLNCPYARDPENMNCTHTAMIESFCAEIRRRQPHGPYHLGGWSSGGAFAYVVAEALV
NSGEEVGSIIIIDAPVPQVMEKLPDSFYKHCNSVGLFANQPGGQGGSTEPPGYLIPHFQA
VVDVMLDYKVAPLKAISGRMPKVGLIWAAETVLKESEAPKMKGMHFMVKKRVDFGPDGWD
GVLPGAEFDIVKAEGANHFTLMSKEHVGLISDLIDRVMSGYTG
NT seq 6792 nt NT seq  +upstreamnt  +downstreamnt
atgagccttttttctctttcttgcttccccgtacctataaccatgtggtcaccttcctcc
catcatcatactccttcgaccgcctttcacacaccagccatggccaacaatacaagcata
tttctcttcggagaccaaacatttgactttgtgccaaagctgcgcgagctcttgactgtt
caggactgtcctctcctggcagccttcctgggccaggctcattatgttgtccgggcacag
atgatccgatcgctgccgccgcaagagcacaaactctccaggacggccaacctggctgag
atgttgcaaaagtatgccgacgggaagttaaacccagcatttcagactgccttgtcgtgt
atatcccagctgggcagctttatgcagacatacgaagaagacagcacaaagccctacccg
cgtgccaatgatagctacgttttgggtgtatgtaccggctcgcttgccgccgctgccatc
agctgcagcagctctctctcagaactgctacccatagccgtccaaacggccttgatagca
ttccgtcttggcctctgtgcgctcgaaatgcgagacagtctcgagacatcggctcccgat
cgtgcacgtccatggtctgttgtcgtctcaggtcttatgccacaagtcgccgaggcattc
gtgaaggagttctgtgatgggaatgccctgcccaagactcgatatccctggattacagct
actgccgccaagtcaacaactatcactggaagcccccgtgttctggaccagctgcttgct
gccaagtcattcaacggctacaaaacaacggagattccagtctttgtgccatcgcacggc
gaccatctcttcacgtccaaagacatcgatttcatcctggagactactgctgttgcgcca
tggtcgggctattcagccaagatccctttcctgtcaagcgcgtccggcaagttagtgtgg
gtggcaaacttcagagctcttgtcgagctggcactgtctcagtgtctcctggtacccatc
ggctgggacaaggttgagaccgaagtgcctcgtctactcaagtctcgcggtgttagcagc
gctgtcatcgctcccgtggggtcatccgctcaaaagagcctgtcgtcagctctagcaaca
ggcggtatcgccaatgaaattgggaccgtgaccggtgggaccaacaggttttcccatcgc
cccggaagcaacaggtgcaagcttgccattgtttccatgtcgggaagatttcccgaggct
cagagtactgatgccttctgggatctcctatacaaaggcgtcgacacgtgcaaagaggtg
ccacgtcgacgatgggacgtcagaacccatgtagacgacaccggcaaggctcgcaacaaa
ggcgccacacgatggggctgctggctggactttacagctgagtttgacccgcggttcttt
agcatttcgcccaaggaggcgcctcagatggatccggcccagcgaatgtcgttgatgtcg
acgtacgaggccatggagcgtgccggcatcgtccccgatacaactccatccacgcagcgc
aaccgtattggggtgttccatggtgtcactagcaacgattggatggagaccaacacggcc
cagaacatcgacacgcactttattacgggaggcaacagaggcttcatccccggccgtatc
aacttttgcttcgagttctcgggcccaagctacagcaatgacactgcttgctcgtccagt
ttggcagcgatccacctggcctgcaactcgctctggcgcggtgactgtgatacagctgtt
gctggtggtaccaacatgatcttcacgcccgatggccacaccggtcttgacaagggcttc
tttttgtctcgtactggaaactgcaagccgtttgacgacgctgcggatggctactgccgt
gctgagggtgttggcactgtcttcatcaagcgattggaggatgccttggctgacaatgat
cccatcctcgccaccatcctcgacgccaagacgaaccactctgccatgtcagactcgatg
acgagaccacacgtcggcgctcaaatcgagaacatgactgctgtgcttagcagtgcctgt
gttgggcccaacgagctgagctacatcgagatgcacgggaccggcacccaggtcggggac
gcggtcgaaatggagtctgtgctctccgtctttgcccctgacgaggaggctcgtcccaag
aatcgcccattgtacgttggttctgcgaaagccaatgttggccatggtgaaggtgtctcg
ggcgtgaccagccttgtcaaggtgctcttgatgatgcagcacaacaccattgtgcctcac
tgcgggatcaagcctggaagcaagatcaaccgacattaccctgaccttggagcgcgcaac
gtccacattgccctggagcccaagccgtggcctcggtctaacgggcctcgccgcgttctc
atcaacaacttcagcgccgccggtggcaacacggcactgctggtggaagatgcacccgag
cgccaggacttgtctgcaccagacccgagaaccaaccacattgtcaccgcttctggccat
gtgggaaagtcgctcaagaccaacctggaacgactcctcgagcacattcagagtactccg
aatctctcgatctctcagctgtcatataccaccacagctcgccgctggcatcaccttcac
cgcgtgagcatcaccgggtccaccatcaccgaggtggagcgcagcttgataacggccatc
gccaatggagacggtatcaaccgtcccaagaccaagcccaacgtcgtttttgccttcaca
ggtcaaggctcacagtaccttggtatgggtcgacagttgtacgaggcatatccggtattc
cgtgacgccgttgatcgcttcgaccgtctcgcgcagagccatggcttcccttcttttctg
cacatcatcacctctgctgagggcgacatggatgccatgctccccgtagtggtgcaggtc
ggtctgacatgccttgaaatggcccttggtgacctcctccgatcctttgggctcaggcct
agcgttgtcgtgggacacagtctcggagagtacgcggcgctgtatgtggccggtgtcctt
tcagcgtctgacgcgatttatgtcgtcgggaagcgagccgagcttcttcaggaacgctgt
cagcgcggtacccattctatgctagccgctagagcttcagctgcctctcttaccgagacg
ttggaagggttgagctgtgatgttgcgtgtatcaatggcccgcatgatactgtcgtgagc
ggctcgatcgaggatatcaccgaggcgcaacgtgtcctcgctggaaaggggatcaaggcg
acagtattgaagcttccgtttgcctttcattcggctcaggtgcagccgattctggaagac
tttgagaaactggcaggtggggtgtctttctcaaaaccggttgtgcctgtcttgtcgcca
ctattgggcaatatcattaacgaggaaggtgccatcggtgccaactatcttgccagacat
tgccgcgaggcggtcgatatggtcaaagctctcgagacagccagagataagggcctcatc
aacgataagaccatcatcgtcgagcttgggccaaaaccgttgctcagcggcatggtgaag
atgacactcggaaacaacatgaccacgctatccactctgcatcagaatacagacgtctgg
cctaatctcaccaccatcctgtcgaccatctacactgctggtctcgacgtcaactgggtc
gcctatcacgccccttttgactcggccaagaaagtgatccctctacccgactatggctgg
gacttgaaggagtactacatcccttacgaaggcgactggtgcctgcaccgccacgagatc
aaatgcgactgcgctgatgccggcaaagaggtgcacacttctgcctaccaggtgcccacc
gagtcgccccttcgcaagccatcaaagctggatgccacgaaagaagcctaccctgaaatc
aagactacaaccactgtccaccgtgtggtcgaagagaagacagagccgttgggagccacc
tttatcgtcgaaacagacatgtcccgtgccgatgtcaaccctatcgcacaaggccacctc
gtcgatggcatccccctcgccacgccttcattctacgccgacattgccctccaagtcggc
agatactccatggcccgactgcgagccggacaccccggagccctggacggcctcgttgac
gtgtgtgatcttgttgtcgacaaagcccttattccccacggacaaggtccccagctcctc
cgcactaccttgacaatgagctggcctcccaaggcagccgccaccacccggaaagccacc
gtcaagttcgcaacatatctccccgacggaaagctcgacacggagcacgccacctgcaga
gtccgcttcactacagatgcccagcacaagtccctccaaaagaaagtacccgactacaag
gccaagatccaccagctccacgatggcatggcgaagggaagatgcctccgatacacccgc
aagagcgggtacaagctcatgagcagcatggctactttccaccctgattacaagctcctc
gacaatctgattctcaatgaggcagaaaatgaagcaacttgtaagatgaacttttccgat
gccaagagcgaaggggactttgctgcccatccagcgtatgtggatgccatcacccaggtg
gctgggtttgccatgaacgccagtgacgagacggatattgccaaggaggtgtatgtcaac
catggctgggggtcgttgcagatctatgagccgctagtgaaggggaaggagtatgaggtt
tacaccaagttcagcagggataaggggggtgatcttgctcacggtgatgtggttgttctg
catggggacaaagtggtggcgttctttgggaatctgtcgctgcggaacgtgccacgaaag
gcattgcatgttgtgctcaagtcagcacttgacaaaggcatccgtcaacgcggcggaaac
ccgacagctcctgcgaagtccaagccatcatttgttgatgtcaaaccaacgcctgctccg
atgacgacgaagcaagcaacccagccagcgtcagcctcagacccggtgaagaaaaggaca
gcccctaaacccaaggcaaagacttgtgggacacccaatgatgagaagttccacgcggtc
ctgcgggttgtttccgaggagagcggtgttgctctcgaggagctcacagatgagagcaac
tttgtcgacatgggcatcgactcactgagctccatggtgattggcagtagaatgagggaa
gacttgggcatggacatggcctcggaattctcgctcttcattgactgcccaactgttggt
gccttgagaaactacttgggtgcttcttctaccgcagcagaagtagaagatgacgaagat
gacgaataccatgacgccgagccggttgcaagtcaacagacacaagacccatactttgca
catgttacaacccgagcttccgatgtattggcaacacccaccacggagtctggcgcagcc
ttcgacagcagccagtttcctgccgcactgaagatcatctctgaggaaagcggcgtcgcg
attgaagaactcaccaccgagacaatcttttccgacattggtatagactccctcagctcc
atggtcatctccagtcgtttcaaagaggaactcggcctaggcctcgactcagccttctcc
ctcttcgacgacgtccccaccgtggccaaactctccgcgttcctcaacaacaacaacaac
aacaacaacaacagcagcagcaatcttgctccggaagaagtcgcctccatctcttccacc
acctcagacctagaccatagctcctctatccacgaaagcagcagcagcagcgccagcgaa
cccgaggatgacgacaacgattaccccccatccatcaagcgcgtgccacactgccgtccc
tgcacgtccgtcatcctccaaagcctcccccgcgtcgcaaaaagaaccctctttctcctc
ccggacggcggcggctccgcatcctcctacgtccccctcccccgcctcaaatccgacgtc
gccgtcgtcggcctcaactgcccctacgcgcgcgaccccgaaaacatgaactgcacccac
acagccatgatcgagtctttttgtgccgaaatccggcgccgccaaccccacgggccatat
cacctaggcgggtggtcctcgggtggggcgttcgcctacgtcgtggcggaggcgctggtg
aattccggggaggaggtcgggagcatcatcatcatcgacgcgccggtgccacaggtgatg
gagaagttgccggatagcttttacaagcattgtaatagtgtggggttgtttgcgaaccag
cctggggggcaggggggtagtactgagccgccggggtatttgattccgcattttcaggcg
gtggtggatgtcatgttggattacaaggttgctccgcttaaagccatcagtggtaggatg
cccaaggtgggcttgatttgggctgcggagactgtgttaaaggagagcgaggcgccgaag
atgaaggggatgcattttatggtgaagaagagggttgattttggaccggatgggtgggat
ggggtgctgcctggggccgagtttgatattgtgaaggcggagggggcgaatcattttacg
cttatgagcaaggagcatgtcgggttgattagcgatctgattgaccgtgttatgagtggt
tatactgggtga

DBGET integrated database retrieval system