KEGG   Planococcus antarcticus: BBH88_02360Help
Entry
BBH88_02360       CDS       T04428                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
pana  Planococcus antarcticus
Pathway
pana03010  Ribosome
Brite
KEGG Orthology (KO) [BR:pana00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    BBH88_02360
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:pana03011]
    BBH88_02360
Ribosome [BR:pana03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    BBH88_02360
  Bacteria
    BBH88_02360
  Archaea
    BBH88_02360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: ANU09250
UniProt: A0A1C7DCL6
Position
149459..149800
Genome map
AA seq 113 aa AA seqDB search
MQAKAVARTVRIAPRKVRLVVDLIRGKQIGEAVAILNHTPKAASIVVEKLLKSAAANAEH
NYEMDLNDLVISEVFVDEGPTLKRFRPRAMGRASAINKRTSHITLVVSDKKEG
NT seq 342 nt NT seq  +upstreamnt  +downstreamnt
atgcaagcaaaagctgtcgctagaacagtacgtattgctcctcgtaaagtccgtttagta
gtagatttaatccgaggcaagcaaatcggcgaagctgttgcaattttaaaccacactccg
aaagcagcatctattgttgttgagaagttattgaaatctgcagctgctaacgctgaacac
aactacgaaatggatctgaatgacttggtcatcagtgaagtgttcgttgacgaaggacca
acacttaaacgtttccgtccacgtgcaatgggacgcgcaagcgcaattaataaacgcaca
agccacatcactctagtggtatctgacaagaaggaggggtaa

DBGET integrated database retrieval system