KEGG   Planococcus antarcticus: BBH88_03445Help
Entry
BBH88_03445       CDS       T04428                                 

Definition
(GenBank) malate:quinone oxidoreductase
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
pana  Planococcus antarcticus
Pathway
pana00020  Citrate cycle (TCA cycle)
pana00620  Pyruvate metabolism
pana01100  Metabolic pathways
pana01110  Biosynthesis of secondary metabolites
pana01120  Microbial metabolism in diverse environments
pana01130  Biosynthesis of antibiotics
pana01200  Carbon metabolism
Module
pana_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pana_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pana00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BBH88_03445
   00620 Pyruvate metabolism
    BBH88_03445
Enzymes [BR:pana01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     BBH88_03445
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo DAO K_oxygenase TPP_enzyme_M HI0933_like Pyr_redox Pyr_redox_2 MCRA
Motif
Other DBs
NCBI-ProteinID: ANU09430
UniProt: A0A1C7DD37
Position
complement(3678554..3680053)
Genome map
AA seq 499 aa AA seqDB search
MDNHQKKRNVILIGAGVMSATLGSMLKELAPDWNIKVFEKLEKAGSESSNEWNNAGTGHA
ALCELNYTPEQADGSVDIKKAITINEQFQLSRQFWSFLVNNKRIANPRDFIMSIPHMSLV
QGEDNVRFLNNRFDALSKSPLFKGMEYSADPEKLKEWIPLIMEGRTSNEAMAATKIDTGT
DVNFGALTEMLFTHLEEQQVEMNYNHAVKDIKRSGDSTWEVKVQDMENNKIEYHSADFVF
IGGGGGSLPLLQKTGIPESKHIGGFPVSGMFLVCNDPEIVEQHHAKVYGKAKVGAPPMSV
PHLDTRFIDNKKSLLFGPFAGFSPKFLKTGSNMDLIGSVKPNNVFTMLAAGAKEMSLTKY
LVQQVLLSNEKRVEELREFIPTAKLKDWDVVVAGQRVQVIKDTDKGKGTLQFGTEIVTAA
DGSVAALLGASPGASTAVHAMLEIFKKCFPDEVGGWEPKIKEMIPSYGVSLSDNPELLQE
IHTLTAKALELDEKSPIKI
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atggacaaccatcagaaaaaaagaaacgttatcttaatcggtgccggagtcatgagtgca
actttaggatccatgcttaaagagttagcaccggattggaatattaaagtgtttgaaaag
cttgaaaaagcagggtccgaaagctcgaacgaatggaataatgctggaacagggcacgct
gccctttgcgaacttaactatacaccagaacaagcggatggttctgtagatatcaaaaag
gcaattaccatcaatgaacagttccagctttcaagacagttctggtctttccttgtaaac
aataaacgcatcgccaatcctagagactttatcatgtcgattcctcacatgagtttggtg
caaggggaagacaatgtccgtttcttaaacaatcgatttgacgcattgtctaaaagtcct
ttatttaaaggaatggaatactcagccgatcctgagaagttaaaagaatggattccactt
atcatggaaggccgcacttcaaatgaagcaatggcggcaacaaaaatcgataccggtact
gacgtcaactttggcgctttaacggaaatgctctttactcacttggaagaacaacaagtc
gaaatgaactacaaccatgcggtcaaagatattaaacgcagcggtgatagcacatgggaa
gtaaaagtacaggacatggaaaacaataaaatcgaataccacagcgcggacttcgtcttt
atcggcggcggtggtgggagcttgcctttgcttcaaaaaacaggcattccggaatctaag
catattggtggattcccggttagcggaatgttcttagtctgcaacgaccctgaaattgtc
gagcaacatcatgcaaaagtatatggaaaagcgaaagtcggagctcctccgatgtcagta
ccgcatttggatacacgctttatcgacaacaagaaatctttgttgttcgggccgtttgca
ggtttctcgccgaagttcctgaaaacaggttcgaatatggacttgattggctctgtgaaa
ccgaataacgtctttacgatgcttgccgcaggcgctaaagaaatgtctttaactaaatat
cttgttcaacaagtcttgctatcgaatgaaaaacgcgtagaagaattgcgtgaatttatc
ccgactgccaaacttaaagactgggatgtagttgtagcaggacaacgtgtacaggttatc
aaggatacggacaaaggcaaagggacgttgcagtttggtacagaaatcgtcacagctgcg
gatggctcagttgctgcattgctgggagcttctccaggtgcttccacggccgttcatgcg
atgcttgaaatcttcaaaaaatgtttcccggacgaagtaggcggatgggaaccaaaaatc
aaagaaatgattccgtcttacggtgtttcattgtctgacaaccctgagcttcttcaggaa
attcacactttaacagctaaagcactcgagctggatgaaaaaagcccgataaaaatataa

DBGET integrated database retrieval system