KEGG   Planococcus antarcticus: BBH88_07405Help
Entry
BBH88_07405       CDS       T04428                                 

Definition
(GenBank) threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
pana  Planococcus antarcticus
Pathway
pana00260  Glycine, serine and threonine metabolism
pana01100  Metabolic pathways
pana01110  Biosynthesis of secondary metabolites
pana01120  Microbial metabolism in diverse environments
pana01130  Biosynthesis of antibiotics
pana01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pana00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BBH88_07405
Enzymes [BR:pana01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     BBH88_07405
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_5 Aminotran_1_2 DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-ProteinID: ANU10139
UniProt: A0A1C7DF17
Position
complement(2842754..2843629)
Genome map
AA seq 291 aa AA seqDB search
MTQKMFASDKNSGVHPLILEAMGQANDGHVPAYGNDPYTAAAIQKFKEHFGEECEVVFVF
NGTGANVTGLKAMVRSHQAIICTDGAHINSDEGGAPEGFIGGKLLTSPSADGKLTISQIE
RQLHHIGNPQRSQPKAISISQCTELGTVYTIDEIKEITSYAHENGLYVHMDGARLSNAAA
YLDCSFAEMTVDAGIDMLAFGGTKNGLMIGEAVVCFNPELAPEITYIRKQGMQLGSKMRF
LSVQFDRLLTENLWLDNARSANHSAQLLAEGLSAFPEIRIVWVPGTQKIPD
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgacacagaaaatgtttgcaagcgataagaattcaggagttcacccactcattttagaa
gccatgggacaagcgaatgatggacatgttccggcttacggaaacgatccgtatacggca
gcggccatccaaaaattcaaagaacatttcggtgaagaatgcgaagtggtatttgttttt
aatggcacgggtgccaatgtgacagggttgaaagcaatggttcgctcgcaccaggcaatt
atctgcacggacggcgcccatataaactccgatgaaggcggcgcgccggaagggtttatt
ggcggcaaactgctaacttccccgtcagcggacggcaaactgacgattagccaaattgag
cggcaattgcaccacatcggcaatccgcagcgaagccaaccaaaagccatttccatctca
caatgtacggaactcggaacggtttacacaattgatgaaatcaaagaaattacttcttat
gcccatgaaaatggactttatgtacatatggacggagcacgactaagcaacgcagcagcc
tatctcgattgcagttttgccgaaatgacagtggacgctggcatcgacatgctggcgttt
ggcggaaccaaaaatggcttgatgattggagaagcagtcgtctgttttaatccggaattg
gcgcctgagatcacatacattcgaaaacaaggcatgcaactggggtccaaaatgcgcttt
ctgtcggtgcaattcgaccggttattaacagaaaacttgtggctggataacgcccgaagc
gccaatcactcggcgcagctacttgcagaagggttatcggcattcccggaaatcagaatt
gtttgggtgccaggcacccaaaaaattccggattag

DBGET integrated database retrieval system