KEGG   Planococcus antarcticus: BBH88_09950Help
Entry
BBH88_09950       CDS       T04428                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pana  Planococcus antarcticus
Pathway
pana00071  Fatty acid degradation
pana00072  Synthesis and degradation of ketone bodies
pana00280  Valine, leucine and isoleucine degradation
pana00310  Lysine degradation
pana00362  Benzoate degradation
pana00380  Tryptophan metabolism
pana00620  Pyruvate metabolism
pana00630  Glyoxylate and dicarboxylate metabolism
pana00640  Propanoate metabolism
pana00650  Butanoate metabolism
pana00900  Terpenoid backbone biosynthesis
pana01100  Metabolic pathways
pana01110  Biosynthesis of secondary metabolites
pana01120  Microbial metabolism in diverse environments
pana01130  Biosynthesis of antibiotics
pana01200  Carbon metabolism
pana01212  Fatty acid metabolism
pana02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pana00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BBH88_09950
   00630 Glyoxylate and dicarboxylate metabolism
    BBH88_09950
   00640 Propanoate metabolism
    BBH88_09950
   00650 Butanoate metabolism
    BBH88_09950
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BBH88_09950
   00072 Synthesis and degradation of ketone bodies
    BBH88_09950
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BBH88_09950
   00310 Lysine degradation
    BBH88_09950
   00380 Tryptophan metabolism
    BBH88_09950
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BBH88_09950
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BBH88_09950
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BBH88_09950
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pana04147]
    BBH88_09950
Enzymes [BR:pana01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BBH88_09950
Exosome [BR:pana04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BBH88_09950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ANU10608
UniProt: A0A1C7DGS3
Position
complement(2296737..2297921)
Genome map
AA seq 394 aa AA seqDB search
MSQEIVIVSAVRTAVGSFQGALKDIPATKLGAIVIKEAIERAGIQSDQVSEVIMGNVLQA
GLGQNPARQASIHAGLPESVPAMTINKVCGSGLKSIQLAFQAIYAGDAEIVVAGGMENMS
RAPYLMENARSGFRMGDQKLVDSMLVDGLTCAFNDYHMGVTAENLCDRYDITREEQDKFA
ARSQARATAAIESGRFDDEIVPVEIPQRKGEPVIFKTDEYVKSSSNEEKLAELRPAFKKE
GSVTAGNSSGINDGAAAVVVMSKAKANELGLTPLATIVASGTAGVDPAVMGIGPVQAVKN
ALSKADMSLGDIELIEANEAFASQSISVDRELAFNHDILNVNGGAIAIGHPIGASGTRIF
VTLLHEMIKRDAKTGLATLCIGGGQGIATVIKRS
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgtcacaagaaatcgttattgtaagcgctgtccgaacagcggtcggttcattccaaggg
gcgcttaaggatattccagctacaaaattaggggcaattgtcattaaagaagcgattgaa
cgtgcaggaattcaatcagatcaagtttctgaagtcattatgggcaatgtactacaagca
ggacttggtcaaaatccagcgagacaagcatcaattcatgcaggactaccggaaagtgta
ccggctatgaccattaataaagtttgcggatctggattaaaatctatccaattggctttt
caagcgatttatgctggagatgcagaaatcgttgtagcaggtggcatggaaaatatgagt
cgcgctccttatttaatggaaaacgctcgcagtggtttccgtatgggcgatcagaaacta
gttgatagtatgttggtcgacggattaacgtgtgcatttaatgattaccatatgggcgtt
acagcagaaaatttatgtgatcgttacgatataacgcgtgaagagcaagataaatttgcg
gcgcgttcacaagcgcgtgcaacagctgcgattgaatcgggtcgatttgatgatgaaata
gtaccagtagaaattccgcaacgaaaaggagagccagtcatctttaagacagatgaatac
gttaaaagttcttccaatgaagaaaaattagcggagttgcgtccggcatttaaaaaagag
ggcagtgtgacagctggtaactcatcaggtatcaatgacggtgcagcggcagtcgttgtt
atgtcaaaagcaaaagcaaacgaattaggattgacaccactcgcaacaatcgtagcaagt
ggtactgctggagtagatcctgctgtaatgggaattggtcctgtacaagcagtgaaaaat
gctttgagtaaagcagacatgtcacttggggatatcgagttgatcgaagcaaatgaagcg
tttgcgtctcagtcgatttcagtagaccgcgaattagcgtttaaccatgacatcttaaat
gttaacgggggagcgattgcgattgggcatcctatcggcgcaagcggcacacgcattttc
gtcacactgctgcatgaaatgatcaagcgcgatgccaagacaggtcttgcgactttgtgc
atcggcggtggtcaaggaattgcgactgttattaaacgctcataa

DBGET integrated database retrieval system