KEGG   Paenisporosarcina antarctica: E2636_03660Help
Entry
E2636_03660       CDS       T05927                                 

Gene name
tenA
Definition
(GenBank) thiaminase II
  KO
K03707  thiaminase (transcriptional activator TenA) [EC:3.5.99.2]
Organism
panc  Paenisporosarcina antarctica
Pathway
panc00730  Thiamine metabolism
panc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:panc00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    E2636_03660 (tenA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:panc03000]
    E2636_03660 (tenA)
Enzymes [BR:panc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.99  In other compounds
    3.5.99.2  aminopyrimidine aminohydrolase
     E2636_03660 (tenA)
Transcription factors [BR:panc03000]
 Prokaryotic type
  Other transcription factors
   Others
    E2636_03660 (tenA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TENA_THI-4 TPR_MLP1_2
Motif
Other DBs
NCBI-ProteinID: QBP40300
UniProt: A0A4P6ZUY9
Position
747213..747893
Genome map
AA seq 226 aa AA seqDB search
MTFSKLLREESDYIWKASFHHPFVIGIGDGTLSLESFRYYVMQDSYYLSHFARVQALGAA
RAKDLDTTSRLASHAQGTYEAELSLHRNFSRRLGITEAEQANFKPSPTAYAYTSHMYRVA
YQGHLGDIIAAILPCYWLYYEIGEKLQTCSPEEPIYQDWIAAYGGEGFRTLVEEQINRLD
KIAEKLTEDDREQMKEHFIISSHYEYSFWEMAYNLEGWPVRKGALN
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgacattttctaagcttttaagagaggaatccgattacatttggaaagcaagctttcat
catccgtttgtaatcggaattggggatggtacattgtctttagaaagtttcaggtattac
gtcatgcaggattcttattatttgtcccattttgcaagggttcaagctttaggtgctgca
agggcaaaggatcttgacactacaagtagattagcatctcatgcacagggaacatatgaa
gcagaattgtctttacatcgaaacttttcacgtcgtcttggaattactgaagcagaacaa
gcaaacttcaagccgtcacctactgcttatgcatatacatcccatatgtatcgtgtggca
tatcaaggacatttaggtgatattatcgcagcaatattaccttgctactggctttactat
gaaattggggagaaactgcagacgtgttcccctgaagaaccaatttaccaagattggatt
gcagcatatggtggagaaggttttagaacattagtcgaggaacaaattaatagactagac
aagattgctgaaaagctaacagaggatgaccgtgagcaaatgaaagaacattttatcatt
agtagtcattacgaatattcattttgggaaatggcttacaatttagagggatggccggtc
cgaaaaggagcattgaattaa

DBGET integrated database retrieval system