KEGG   Paenisporosarcina antarctica: E2636_12550Help
Entry
E2636_12550       CDS       T05927                                 

Gene name
lhgO
Definition
(GenBank) L-2-hydroxyglutarate oxidase
  KO
K15736  (S)-2-hydroxyglutarate dehydrogenase [EC:1.1.5.13]
Organism
panc  Paenisporosarcina antarctica
Pathway
panc00310  Lysine degradation
panc01100  Metabolic pathways
panc01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:panc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    E2636_12550 (lhgO)
Enzymes [BR:panc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.13  (S)-2-hydroxyglutarate dehydrogenase
     E2636_12550 (lhgO)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO Pyr_redox_3 Pyr_redox_2 Mqo Lycopene_cycl NAD_binding_8 Amino_oxidase Thi4 FAD_binding_3 FAD_binding_2
Motif
Other DBs
NCBI-ProteinID: QBP41929
UniProt: A0A4P7A0K9
Position
2562298..2563512
Genome map
AA seq 404 aa AA seqDB search
MYDFAVIGGGIVGLSTGMALYKRFPNAKVVIIEKESVVADHQTGHNSGVIHSGIYYKPGS
YKARFARQGSKSMTDFCQTHGINHDICGKVIVATKQEELVLLDNLYTRGLQNDLVIQKIG
AAELKEIEPHVNGLGAIRVAQAGIVNYREVSEKFADIILEHGGEIQLNTKVEKIHEESDQ
VVIETSKGILKARMVINCAGLHSDRIATAAGYKTDMKIVPFRGEYFKLKPEKRYLVKHLI
YPVPNPNFPFLGVHFTRMISGEIDAGPNAVLSFKREGYKKTDFNAKDLMEVLGYPGFWKL
ASKFMKEGMDEYVRSFSKKQFTKSLQELIPEIQEDDLIPAPAGVRAQGLKSDGNLVDDFY
IVMGKRTIHVCNAPSPAATASIEIGKEVVSRIPVQIHLLEMALV
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
gtgtatgatttcgcggttattggtggaggaatagtaggtttatcaacgggaatggcactt
tataaacggtttcctaatgcaaaagtagttattattgaaaaggagtctgttgttgcggac
caccaaacagggcataacagtggggttattcattctggtatttattataaaccaggcagt
tacaaagctcgttttgcacgtcaaggaagcaagtcgatgactgatttctgtcaaacacac
gggattaatcatgatatttgtggaaaagttattgtcgcaaccaagcaagaagagttagtg
cttcttgataatttatatactagaggactccaaaatgatctagttatccaaaaaattggt
gcggctgaattaaaggaaatcgaaccacatgttaacggtcttggggcgattcgtgttgca
caagctggtatcgtaaattatcgtgaggtaagtgaaaaattcgcagatattattttggag
catggcggggaaattcagttaaatacaaaagtagaaaaaattcacgaagaatcagatcaa
gtagtaatcgagacaagcaaaggtattttgaaagcgcgtatggttattaattgtgccggt
cttcacagtgaccgaatagctactgcagcgggttataaaactgacatgaagatcgttccg
ttccgtggagagtattttaaattgaaaccggaaaaacgatatcttgttaaacatttaata
tacccagtaccaaatccgaatttcccatttttaggggtccatttcacacgcatgatcagc
ggagaaattgatgcaggacctaatgctgtgctaagttttaaacgtgaagggtataaaaag
actgatttcaatgcaaaagatctaatggaagtattaggttatcctggtttttggaaatta
gcaagtaaatttatgaaagaaggaatggatgaatacgtccgttcatttagcaaaaagcaa
tttacgaaaagccttcaagaattaatacctgaaatccaggaagatgatttaattccagca
cctgcaggcgttcgtgcgcagggattaaagagcgatgggaatttggtagatgacttttac
atcgtcatgggaaaacggaccatacatgtttgtaatgcgccctcccccgctgccaccgct
tctattgaaattggtaaagaagtggttagccgtattccagtgcaaatacacttattagaa
atggctttagtttaa

DBGET integrated database retrieval system