KEGG   Paenisporosarcina antarctica: E2636_18265Help
Entry
E2636_18265       CDS       T05927                                 

Gene name
metG
Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
panc  Paenisporosarcina antarctica
Pathway
panc00450  Selenocompound metabolism
panc00970  Aminoacyl-tRNA biosynthesis
panc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:panc00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    E2636_18265 (metG)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    E2636_18265 (metG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:panc01007]
    E2636_18265 (metG)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:panc03016]
    E2636_18265 (metG)
Enzymes [BR:panc01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     E2636_18265 (metG)
Amino acid related enzymes [BR:panc01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   E2636_18265 (metG)
Transfer RNA biogenesis [BR:panc03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    E2636_18265 (metG)
 Prokaryotic type
   Other AARSs
    E2636_18265 (metG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA_bind tRNA-synt_1e tRNA-synt_1f Anticodon_1 zf-Mss51
Motif
Other DBs
NCBI-ProteinID: QBP42960
UniProt: A0A4P7A1P5
Position
3845796..3847754
Genome map
AA seq 652 aa AA seqDB search
MNNQKKSFYITTPIYYPSGKFHIGTAYTTVASDVMARYKRLRGYNVHFLTGMDEHGQKIQ
EKAQEAGKDPQTYVNEIAEDAKKVWELMDISYDDFICTTEKRHKDAVEKIFQLFLDNGDI
YKGEYEGWYCTPCESFYTDNQLDNGNCPDCGRPVHKVKEESYFFNMKKYADRLLKYYEDN
VEFIEPESRKNEMINNFIKPGLEDLSVSRTSFDWGIRVPGDAKHVIYVWVDALSNYITAL
GYKSEDESLFNKYWPADVHVVGKDIVRFHTIYWPIFLMALKLPLPKKVFAHGFIMMKDGK
MSKSKGNVVTPELLVNRYGLDATRYFLLRELPFGADGVFSPEAFVERTNFDLANDLGNLL
NRTVSMINKYFDGIIPTQHNEATEFDATLHAHAKDVKEKYETNMEKMQFSIVLSDLWSLV
SRTNKYIDETQPWVLAKEDSDKPKLGSVMWNLSESLRQIAVYLQPFMTNAPKQIAKQLGL
STDSLTWDSLEQWSSIPIGTKVIEKGVPIFPRLEVETEISYIQEQMRGPVRTEDLETVKE
ETPEIPEITIDDFLNIDLRVATVIACEKMPKADKLLKLQVDLGYEQRQVISGIAKNYSPE
ELVGQKVIVVANLKPVKLRGEMSQGMILAGEQDGYLTLATVDKKLENGAKVK
NT seq 1959 nt NT seq  +upstreamnt  +downstreamnt
gtgaataatcaaaagaaatcattttatattacgactcccatatattacccaagtgggaaa
tttcacattggaacggcttatacaaccgtagcttcagacgtgatggctcgttacaagcgt
ttacgtggatataatgttcattttttaacaggaatggatgagcacggtcaaaaaatacaa
gaaaaagcccaagaagcgggaaaagatccgcaaacctatgtcaatgaaattgcagaagac
gctaaaaaagtttgggaattgatggacatttcatatgacgattttatttgtactactgaa
aaacgtcataaagatgctgtcgaaaaaattttccaactatttttagataacggcgatatt
tacaaaggcgaatatgagggctggtactgtacgccatgtgaatcattttatacggacaac
caattagataatggtaattgtccagattgtgggcgcccagtacataaagtcaaagaagag
tcgtatttcttcaatatgaaaaagtatgcagatcgcttactgaaatattatgaagataat
gtagaattcattgagcctgaatctagaaaaaatgaaatgattaacaactttattaaacca
ggattagaagatttgtctgtgtctcgaacttcatttgattggggaattcgtgtacctggt
gatgcaaaacatgtcatttacgtatgggttgacgctttatccaattacattacagcactt
ggatataaatcagaagatgaatcattatttaataagtattggcctgcagatgtacatgtt
gtcgggaaagacatcgtcaggttccatacgatatactggccaatcttcttaatggcatta
aaattaccgctacctaaaaaagtctttgcacacggatttattatgatgaaagacggtaaa
atgtctaaatctaaagggaatgttgtcacaccggaactattagttaatcgctacggttta
gatgctactcgctatttcttattgcgtgagttgccctttggtgcagatggcgtattttca
ccggaagcctttgtggaacgcacaaactttgacttagcaaatgacttagggaacttattg
aatcggactgtttcgatgatcaataagtattttgatggaattattccaacacaacataac
gaggcaacagaatttgatgccacattacacgcacatgcgaaagatgtaaaagaaaagtat
gaaacaaatatggaaaaaatgcagtttagcatcgtattgagcgacttatggtcactcgtt
tcacgcaccaataaatacattgatgaaacacaaccatgggtcttagctaaagaagattca
gacaaaccaaaactcggatcggttatgtggaacttgtcagaaagccttcgtcaaattgct
gtgtatctacaaccgtttatgacaaatgctcccaagcagattgcgaagcagcttggctta
tctacggattcattgacgtgggattcattagaacagtggtcaagtattccgattggaaca
aaagtgattgaaaaaggcgtaccaattttcccgagattggaagttgaaactgaaatatca
tatattcaagaacaaatgcgtggacctgtaagaacagaagaccttgaaacagtaaaagaa
gagacaccagaaattccagaaataacaatagatgatttcttaaatatagatttgcgtgta
gccaccgtgattgcctgtgaaaaaatgcctaaagcggataaattattgaaactacaagta
gatctaggatatgagcaacgtcaagttatatcagggattgctaaaaactatagtccagaa
gaattagtcggtcaaaaagtaattgttgtagctaacttaaaacctgtgaaacttcgtggg
gagatgtctcaagggatgattcttgcaggagagcaagatggatatttaacacttgcaacc
gttgataagaaacttgagaacggtgcgaaagtaaaataa

DBGET integrated database retrieval system