KEGG   Pandoraea sp. XY-2: DRB87_05235Help
Entry
DRB87_05235       CDS       T06086                                 

Gene name
hemL
Definition
(GenBank) glutamate-1-semialdehyde-2,1-aminomutase
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
pand  Pandoraea sp. XY-2
Pathway
pand00860  Porphyrin and chlorophyll metabolism
pand01100  Metabolic pathways
pand01110  Biosynthesis of secondary metabolites
pand01120  Microbial metabolism in diverse environments
Module
pand_M00121  Heme biosynthesis, plants and bacteria, glutamate => heme
Brite
KEGG Orthology (KO) [BR:pand00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    DRB87_05235 (hemL)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:pand01007]
    DRB87_05235 (hemL)
Enzymes [BR:pand01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     DRB87_05235 (hemL)
Amino acid related enzymes [BR:pand01007]
 Aminotransferase (transaminase)
  Class III
   DRB87_05235 (hemL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: QBC30885
UniProt: A0A411J922
Position
complement(1124490..1125794)
Genome map
AA seq 434 aa AA seqDB search
MSEHTTNAALFERAQQTIPGGVNSPVRAFRSVGGTPRFIARAQGPYMWDAEGTRYIDYIG
SWGPMIVGHLHPDVVAAVHAAMSQGFSFGAPTEAEVVMAETLSALVPSIEQVRLVSSGTE
ATMSALRLARGFTGRNKIVKFEGCYHGHADSLLVKAGSGLLTFADSTRNAPSSAGVPPEV
TRDTLVLEYNNVEQLRELFADQGGEIAAVIVEPVAGNMNLVRGSRHFLQTLRELCTAHGA
VLIFDEVMCGFRVGLGGAQALYGITADLTCLGKVIGGGMPAAAFGGRRDIMSHLAPLGGV
YQAGTLSGNPLAVAAGLATLKLIQAPGFYEDLAKRTSKLVTGLVDAAQTAGVPFSGDSVG
GMFGLYFRANVPQSFAEVTTSDVARFNKFFHAMLDRGVYLAPSAFEAGFVSATHDDAIID
ATLDAARDAFRAIA
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgtccgaacacactaccaatgccgcgctcttcgagcgcgcccagcagaccatccccggc
ggcgtgaactcgccggtgcgcgccttccgctcggtcggcggcacgccgcgcttcatcgcc
cgcgcccaaggcccttatatgtgggacgccgaaggcacgcgctacatcgactacatcggc
tcgtggggcccgatgatcgtcggccacctgcatcccgacgtcgtcgctgccgtgcacgcc
gcgatgtcgcaaggcttcagcttcggcgcgcccactgaagccgaagtcgtgatggccgaa
accctcagcgctctcgtgccgtccatcgagcaggtgcgcctggtgtcctcgggcaccgag
gcgacgatgagcgcactgcgcctggcgcgcggcttcaccggccgcaacaagatcgtcaag
ttcgagggctgttatcacggccatgccgacagcttgctcgtgaaggccggctcgggcctg
ctcacgttcgccgattcgacgcgcaacgcgccgtcgtcggccggcgtgccgcccgaagtc
acgcgcgacacgctcgtgctcgagtacaacaacgtcgaacagcttcgcgaactgttcgcg
gaccaaggcggcgagatcgcggccgtgatcgtcgagccggtggccggcaacatgaacctc
gtgcgcggctcgcgtcacttcctgcagacgctgcgcgagctgtgcaccgcccatggcgcc
gtgctcatcttcgacgaggtgatgtgcgggttccgcgtcgggttgggcggcgcgcaagcg
ctctacggcattacggccgacctcacctgcctgggcaaggtcatcggcggcggcatgccc
gccgcggcgttcggcgggcgccgcgacatcatgtcgcatctggcgccgctgggcggcgtc
tatcaggccggcacgctctccggaaatccgctggccgtggccgccgggctcgccacgctc
aagctgattcaggcgccgggcttctacgaggatctggccaagcgcacatcgaagctcgtc
acggggctcgtcgacgccgcccagacggctggcgtgcctttctcgggcgacagcgtcggc
ggcatgttcggtctgtacttccgcgccaacgtgccgcagagcttcgccgaagtgacaacg
tccgacgtggcccgattcaacaagtttttccatgcgatgctcgatcgcggcgtgtatctc
gcgccgagcgccttcgaagcgggcttcgtctctgccacgcacgacgacgcgatcatcgac
gccacgctcgacgctgcccgcgacgcgtttcgtgccatcgcgtga

DBGET integrated database retrieval system