KEGG   Pandoraea sp. XY-2: DRB87_09875Help
Entry
DRB87_09875       CDS       T06086                                 

Definition
(GenBank) inorganic phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
pand  Pandoraea sp. XY-2
Brite
KEGG Orthology (KO) [BR:pand00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    DRB87_09875
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: QBC31608
UniProt: A0A411JB53
Position
2148788..2149798
Genome map
AA seq 336 aa AA seqDB search
MATLHISLWLIGLLVALALLFDFMNGFHDAANSIATVVSTGVLKPHQAVAFAAMFNVIAL
FVFHLKVAATVGKGTVHPEIVDHYVIFGALVGAIAWNVITWYYGIPSSSSHALIGGLVGA
AVAKAGTGSLVTSGLLQTVAFIFISPLLGFVLGSFFMLLVSWLFFRTPPARVDRWFRRLQ
LISAGMYSLGHGGNDAQKTIGIIWMLLIAAGMWPQEAAEPPLWVIVGCYLAIGLGTMFGG
WRIVRTMGQKITKLKPVGGFCAETGGAFTLFFASWLGVPVSTTHTITGAIVGVGATRKLS
AVRWGVAGNIVWAWVLTIPASAFIAAIAWWVGKQIL
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atggcaacgctgcacatcagcctttggctgatcggactgttggtcgcacttgcgctcctg
ttcgacttcatgaatggcttccacgacgccgccaactcgatcgctacggtggtctcgacg
ggcgtgctcaagccgcatcaggcggtggctttcgccgccatgttcaacgtgatcgcgctg
ttcgtctttcatctgaaagtcgcggcgacggtgggcaaggggacggttcatcccgaaatc
gtggatcactacgtgatcttcggcgccctcgtcggggcgattgcgtggaacgtgattact
tggtactacggcattccgtcgagttcgtcgcacgcgctgatcggtgggttggtcggcgct
gcggtggccaaggccggcacgggttcgcttgtcacgagtggactgctgcaaacggtcgcg
ttcattttcatctctccgctgctcggtttcgtgctcggttcgttcttcatgctgctggtg
tcctggttgttcttccgaacgccacccgcgcgcgtggaccgctggttccgccgcctgcag
ctgatttcggccggtatgtacagcctgggacacggcggtaacgatgcccagaagaccatc
ggtatcatctggatgttgctgatcgccgcgggcatgtggccgcaggaggctgcggaaccg
ccgctgtgggtgatcgtgggctgctatctggcgatcggtctgggcaccatgttcggtggc
tggcgcatcgtgcgcacgatggggcagaagatcaccaagctcaagccggtcggtggcttc
tgtgccgaaaccggcggggcgtttacgctgttcttcgcgtcgtggctcggcgtgccggtc
tcgaccacgcacaccatcaccggcgccatcgtgggcgttggcgccacgcgcaagctctcg
gcggtgcgctggggggtggcaggcaacatcgtctgggcatgggtgctgacgatcccggcc
tcggcattcatcgccgcgatcgcgtggtgggtcggcaagcagattctgtga

DBGET integrated database retrieval system