KEGG   Pantoea sp. PSNIH2: PSNIH2_02295Help
Entry
PSNIH2_02295      CDS       T03514                                 

Definition
(GenBank) tRNA pseudouridine synthase C
  KO
K06175  tRNA pseudouridine65 synthase [EC:5.4.99.26]
Organism
panp  Pantoea sp. PSNIH2
Brite
KEGG Orthology (KO) [BR:panp00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:panp03016]
    PSNIH2_02295
Enzymes [BR:panp01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.26  tRNA pseudouridine65 synthase
     PSNIH2_02295
Transfer RNA biogenesis [BR:panp03016]
 Prokaryotic Type
  tRNA modification factors
   Psudouridine synthases
    PSNIH2_02295
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-ProteinID: AIX72718
Position
494713..495492
Genome map
AA seq 259 aa AA seqDB search
MLEIIYQDQWLVAVNKPAGWLVHRSWLDRKEKVVVMQTVRDQIGQHVFTAHRLDRPTSGV
LLMGLSSEVGRLLSQQFELHQMSKTYHAVVRGWLEGADRLDYPLTEELDKIADKYASPDK
GPQPAVTDWQGLAITEQPVAIGRYPTARYSLIELQPATGRKHQLRRHLAHLRHPIIGDTT
HGDLRQNRGAAQHFGCERLMLHASSLALNHPVTGEPLLIRAGLDRYWQRMMQQFGWQHLL
PDLPRVEFDPQPGQDKAPQ
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgctggaaattatctatcaggatcaatggctggtggcggtcaacaaaccggctggctgg
ctggtgcatcgcagctggctggatcgcaaagaaaaagtggtggtgatgcagacggtgcgc
gaccagatcggacaacacgtttttaccgcgcatcgccttgacaggcccacttccggcgta
ttgctgatggggctttccagcgaggtgggacgcctgctgtcgcagcagtttgaactgcat
cagatgagcaaaacctaccacgccgttgtgcgcggctggctggagggcgcggaccgcctt
gactatccgctgaccgaggagctggataagatcgccgataaatacgcctcgccggataaa
gggccgcagcctgctgtgaccgactggcaggggctggcgatcaccgagcagccggtcgcc
atcggccgctaccctactgcgcgctacagcctgatcgaactgcaaccggcaaccggacgc
aagcatcagctgcgtcgtcatctcgcccatctgcgccatccgatcatcggcgacaccacg
catggcgatctgcggcaaaaccgcggcgcggcgcagcatttcggctgcgaacgtttaatg
ctgcacgccagcagcctggcgctgaaccatccggtcacgggcgagccgctgttgattcgc
gccgggctcgatcggtactggcagcgcatgatgcagcagtttggctggcagcaccttctc
cccgatcttcccagggttgagtttgacccgcagccaggtcaggataaggcaccacaataa

DBGET integrated database retrieval system