KEGG   Pantoea sp. PSNIH2: PSNIH2_02415Help
Entry
PSNIH2_02415      CDS       T03514                                 

Definition
(GenBank) sirohydrochlorin ferrochelatase
  KO
K02302  uroporphyrin-III C-methyltransferase / precorrin-2 dehydrogenase / sirohydrochlorin ferrochelatase [EC:2.1.1.107 1.3.1.76 4.99.1.4]
Organism
panp  Pantoea sp. PSNIH2
Pathway
panp00860  Porphyrin and chlorophyll metabolism
panp01100  Metabolic pathways
panp01110  Biosynthesis of secondary metabolites
panp01120  Microbial metabolism in diverse environments
Module
panp_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:panp00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PSNIH2_02415
Enzymes [BR:panp01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.76  precorrin-2 dehydrogenase
     PSNIH2_02415
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     PSNIH2_02415
 4. Lyases
  4.99  Other lyases
   4.99.1  Sole sub-subclass for lyases that do not belong in the other subclasses
    4.99.1.4  sirohydrochlorin ferrochelatase
     PSNIH2_02415
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TP_methylase NAD_binding_7 CysG_dimeriser Sirohm_synth_M Shikimate_DH Peptidase_M17_N 2-Hacid_dh_C TrkA_N
Motif
Other DBs
NCBI-ProteinID: AIX72742
Position
525195..526610
Genome map
AA seq 471 aa AA seqDB search
MDYLPIFADLKAKPVLVVGGGDVAARKIELLRRAGARVQIAARELCAELRELADKQQLEW
LATAFDEAQLDSVYLVIAATDDGALNARVFEAANQRRLLANVVDDQPKCSFIFPSIVDRS
PLVVAISSSGTAPVLARMLREKLEALLPANLGQMAQVAGEWRDKVKQRFSKMSDRRRFWE
RAFNGLFASQMAAGNVQGAKQTLDAQLTDAPPQQGEIILVGAGPGDAGLLTLRALQVMQQ
ADVVLYDHLVSDEILDLVRRDADRLCVGKRAGAHSVAQEETNRLLVQLASKGKRVVRLKG
GDPFIFGRGGEELQAAQEAGIPFQVVPGVTAASGATAYAGIPLTHRDYAQSVLFITGHCR
ADGDAIDWPSLARSRQTLAIYMGTVKAAEISQQLIAHGRAATTPVAVIGRGTRQDQQVLT
GTLAELETLAQQAPTPALLVIGEVVNLHAQLAWFQHSAQQAGRDSAVVNLA
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
gtggattatctccctatatttgccgatctgaaagcaaagccggtgctggttgttggcggc
ggcgatgtggcggcgcgaaaaattgagctgctgcgtcgcgcgggcgcgcgcgtgcagatt
gccgcacgcgaactctgcgccgagctgcgggagctggcggacaaacagcagctggaatgg
ctggcgacagcgttcgacgaggcccagctggatagcgtttacctggtcattgccgccacc
gacgacggcgcgcttaacgcgcgcgtgttcgaggcggcgaaccagcgtcgcctgctggcg
aacgtggtcgacgatcagccgaaatgctcctttatcttcccgtccattgtcgatcgctcg
ccgctggtggtggcgatctcctccagcggcaccgcgccggtgctggcgcgtatgctgcgc
gaaaagctggaggcgctgctgcccgccaacctggggcagatggcgcaggtggcgggggag
tggcgcgataaggtcaaacagcgcttcagcaaaatgtccgatcgtcgtcgcttttgggag
cgcgcgttcaacggtctgttcgccagccagatggcggcgggcaacgtgcagggcgcaaag
cagacgctggacgcgcagttaacggatgcgccgccgcagcagggcgaaattattttagtc
ggcgccggtccgggcgacgcgggcctgctgacgctgcgcgcgttacaggtcatgcagcag
gcggacgtggtgctgtatgaccatctggtcagcgacgagatccttgatttagtgcgccgc
gacgccgaccggctctgcgtcggcaaacgcgccggcgcgcattcggtggcgcaggaagag
accaatcgcctgctggtccagctggcgagcaaagggaaacgcgtagtgcgcctgaagggc
ggcgatccctttatcttcgggcgcggcggcgaagagttgcaggcggcgcaggaagcgggc
attccgttccaggtcgtgccgggagtgacggcggcgtcaggcgctaccgcctatgcgggc
attccgctgacccatcgcgactatgcgcagagcgtgctgtttattaccggacactgccgc
gcagacggcgacgctatcgactggccgtcgctggcgcgttcccgccagacgctggccatc
tatatgggcacggtgaaagcggcggaaatttcgcagcagctcatcgcccatggccgcgca
gcgacgacgccggtcgcggtgatcggacgcggcacgcggcaggatcagcaggtattgacc
ggcacgctggccgagctggaaacgctggctcagcaggcgccgacgcctgcgctgctggtg
atcggcgaagtggtgaatctgcacgcgcagctggcctggtttcaacattcagcgcagcag
gcgggacgcgactccgccgttgtgaatttggcttaa

DBGET integrated database retrieval system