KEGG   Pantoea sp. PSNIH2: PSNIH2_10245Help
Entry
PSNIH2_10245      CDS       T03514                                 

Definition
(GenBank) thymidylate kinase
  KO
K00943  dTMP kinase [EC:2.7.4.9]
Organism
panp  Pantoea sp. PSNIH2
Pathway
panp00240  Pyrimidine metabolism
panp01100  Metabolic pathways
Module
panp_M00053  Pyrimidine deoxyribonuleotide biosynthesis, CDP/CTP => dCDP/dCTP,dTDP/dTTP
Brite
KEGG Orthology (KO) [BR:panp00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    PSNIH2_10245
Enzymes [BR:panp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.9  dTMP kinase
     PSNIH2_10245
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thymidylate_kin dNK AAA_28 AAA_16 AAA_22 AAA_18 AAA_33
Motif
Other DBs
NCBI-ProteinID: AIX74121
Position
complement(2216778..2217410)
Genome map
AA seq 210 aa AA seqDB search
MNGKFIVIEGLEGAGKTTARDCVVEQLREQGITDIVFTREPGGTPLAEKLRDLIKQGLDG
EQITDKAELLMLYAARVQLVETIIKPALARGAWVVGDRHDLSSQAYQGGGRGIDQQLMQA
LRDTVLGDFRPHLTLYLDVTPAIGLQRARARGELDRIEQESLHFFERTRERYLALAASDS
SIKTIDATQSLDEVTLSLRRVVRDWLMEQN
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgaacggtaagtttattgtgattgaaggcctggaaggcgcaggcaaaacgaccgcgcgc
gactgcgtagtggaacagctgcgcgagcagggcattaccgatatcgtttttacccgcgaa
cccggcggtacgccgctggcggaaaagctgcgcgatctgatcaagcagggactggacgga
gagcagataaccgataaggcggagctgttgatgctctacgccgcgcgggtacagctggtg
gaaacgatcatcaagccggcgctggcgcgcggcgcctgggtggtaggcgatcgtcacgat
ctctcgtcgcaggcctaccagggcggcggtcgtggtattgatcagcagttgatgcaggcg
ctgcgcgataccgtgctgggtgactttcgaccgcacctgacgctatacctggacgtcacg
cctgccattggcctgcaacgcgcgcgcgcgcgcggcgaactcgatcgtattgagcaggaa
tcgctgcactttttcgagcgcacccgcgaacgctatctggcgctggcggccagcgattcc
tccatcaaaaccattgatgccacgcagtcgctggatgaggtgacactgtcacttaggcgc
gtcgtgcgtgactggctgatggagcagaactaa

DBGET integrated database retrieval system