KEGG   Pantoea sp. PSNIH2: PSNIH2_11660Help
Entry
PSNIH2_11660      CDS       T03514                                 

Definition
(GenBank) hypothetical protein
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
panp  Pantoea sp. PSNIH2
Brite
KEGG Orthology (KO) [BR:panp00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    PSNIH2_11660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: AIX74368
Position
2530831..2532435
Genome map
AA seq 534 aa AA seqDB search
MSDHGASARYTTRFPTLYPTPSGRRQRLSLLLLGLLSIVGISWMMTQLAADIDYATGGAP
SFLTALLLCSALLLALGFIFINGMHDTANAVTTVIYTGTLSPARAVLISAVANMLGVLLA
SGVVAWGVMSLLPPEGLIALDARHGYALIYALLLAAIVWNFASWYVAIPSSSSHALLGAM
LGVGAASSLLNNQGALTGIDWRQASWAGWALLLSPLLGFLAAGLLLRLMKALLPHSLAVS
VASERRPPLWLRGMLILTSSGVSFAHGANDGQKGMGLMMVILLVALPGAFALNRTLPERE
LASLTLLTAQAQAQLPQRAGLSLTAAQAILDNYRQREGARDGVLPALGTMTASLHQQLDG
IKNLSDLPPTETTTLRLRMTLTADALQRLLEDENPLSASQRALLSSLAAQLNHASSLIPW
WVKIVVALALGLGTLTGWQRIAITIGERTGKAPLTPMQGASSELVTMTTLGVAEQFGLPI
STTQVLTCGVAGSMVASRSALQWRTLKRMGLVWLLTLPVCALLSALLYTLFISL
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaccatggcgcttctgcccgctatacaacccgttttcccacgctgtatccgacg
ccttccggcagacggcagcgcctctccctgctgctgctcgggctgctatcgattgtcggc
atcagctggatgatgacgcagctggctgcggatattgactatgccaccggcggcgcgcca
tcgtttttaaccgcgctactgttatgcagcgcgctgctgctggcgctggggtttatcttt
attaacgggatgcacgacaccgctaacgccgtgacgacggtgatctataccggcacgctt
tcgcccgcccgcgcggtactgatttccgccgtcgcgaatatgctcggcgtgctgctcgcc
agcggcgtagtcgcgtggggcgttatgtctctgctgccgccggaagggttgatcgcgctg
gacgcccgtcacggatatgcgttgatttacgcgttgctgctggcggccatcgtctggaat
ttcgccagctggtatgtcgctatcccctcctcctcttcccatgcgctgctgggcgctatg
ctcggcgtgggcgccgccagcagcctgctgaacaatcagggcgcgctgaccggcattgac
tggcggcaggcaagctgggcggggtgggcgctgctgctctctccgctgctgggctttctc
gccgctggcctgctactgcggctgatgaaggcgctgctgccccattctctcgccgtttcc
gtcgcgtcggagcggcgtcctccactctggctgcgcggcatgctgatcctgaccagcagc
ggcgtctcgtttgcccacggcgctaatgatggtcagaaaggaatgggtctgatgatggta
atcctgctggtcgccctgcccggcgcgttcgcccttaaccgcaccctgccggagcgcgaa
ctcgccagcctgaccctgttgactgcccaggcgcaggcgcagctgccccagcgcgccggt
ctgtcgctgacagcggcgcaggcgatactcgataactaccggcaacgggaaggcgcgcgc
gacggcgtactgccggcgctgggaacgatgaccgccagcctgcatcagcagctggacggg
ataaaaaacctcagcgacctgccgccgacggaaaccacaacgctgcgcctgcgtatgacg
ctgaccgccgacgcgctacagcggttgctggaggatgaaaatccgctgtccgccagtcag
cgtgcgctgctaagcagcctggccgcgcagttgaaccacgccagcagccttattccctgg
tgggtgaaaatcgtggtggcgctggcgctgggacttggcacgctgacgggctggcagcgc
atcgccattaccattggcgaacgcaccggcaaagcaccgctgacgccgatgcagggcgcc
agcagcgaactggtgactatgaccacgctgggcgtggcggaacagtttggtctgccgatc
tctaccacccaggtgctgacctgcggcgtggcgggcagcatggtggcaagccgcagcgct
ttacaatggcgcaccctgaagcgcatggggctggtgtggctgctgaccttgccggtctgc
gcgttgctctccgccctgctttatacgctgtttatctctctgtag

DBGET integrated database retrieval system