KEGG   Pantoea sp. PSNIH2: PSNIH2_18845Help
Entry
PSNIH2_18845      CDS       T03514                                 

Gene name
ompR
Definition
(GenBank) osmolarity response regulator
  KO
K07659  two-component system, OmpR family, phosphate regulon response regulator OmpR
Organism
panp  Pantoea sp. PSNIH2
Pathway
panp02020  Two-component system
Brite
KEGG Orthology (KO) [BR:panp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    PSNIH2_18845 (ompR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:panp02022]
    PSNIH2_18845 (ompR)
Two-component system [BR:panp02022]
 OmpR family
  EnvZ-OmpR (osmotic stress response)
   PSNIH2_18845 (ompR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C FleQ
Motif
Other DBs
NCBI-ProteinID: AIX75612
Position
4097563..4098282
Genome map
AA seq 239 aa AA seqDB search
MQENYKILVVDDDMRLRALLERYLTEQGFQVRSVANAEQMDRLLTRESFHLMVLDLMLPG
EDGLSICRRLRSQSNPMPIIMVTAKGEEVDRIVGLEIGADDYIPKPFNPRELLARIRAVL
RRQANELPGAPSQEEAVIAFGKFKLNLGTREMFREDEPMPLTSGEFAVLKALVSHPREPL
SRDKLMNLARGREYSAMERSIDVQISRLRRMVEEDPAHPRYIQTVWGLGYVFVPDGTKA
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgcaagagaactacaaaattctggtcgtcgatgatgacatgcgcctgcgcgcgctgctg
gaacgttatctgaccgagcagggttttcaggtgcgcagcgtggctaacgccgagcaaatg
gatcgcctgttaacccgcgaatcctttcacctgatggtgcttgatctgatgttgccaggg
gaagatggcctttctatctgccgccgcctgcgtagtcagagcaatccgatgccgatcatt
atggtaacggcgaaaggcgaagaggtcgatcgcatcgtcggtctggagatcggcgcggac
gactatattccaaagccgttcaacccacgcgagctgctggcgcgcatccgcgccgtgctg
cgtcgtcaggctaacgagctgccgggcgcgccatcgcaggaagaggcggtgatcgccttt
ggtaaatttaaactgaatctcggcacccgcgaaatgttccgcgaagatgagccgatgccg
ctgaccagcggcgagttcgcggtgctgaaagcgctggtaagtcatccgcgcgagccgctg
tcgcgcgataagctgatgaacctcgcccgtggccgtgagtacagcgccatggagcgctcc
attgacgtgcagatctcgcgtctgcgccgcatggtggaagaagatccggcccatccgcgc
tatatccagaccgtttggggcctgggctacgtcttcgtcccggacggcacgaaagcatga

DBGET integrated database retrieval system