KEGG   Pantoea sp. PSNIH2: PSNIH2_18855Help
Entry
PSNIH2_18855      CDS       T03514                                 

Definition
(GenBank) phosphoenolpyruvate carboxykinase
  KO
K01610  phosphoenolpyruvate carboxykinase (ATP) [EC:4.1.1.49]
Organism
panp  Pantoea sp. PSNIH2
Pathway
panp00010  Glycolysis / Gluconeogenesis
panp00020  Citrate cycle (TCA cycle)
panp00620  Pyruvate metabolism
panp01100  Metabolic pathways
panp01110  Biosynthesis of secondary metabolites
panp01120  Microbial metabolism in diverse environments
panp01130  Biosynthesis of antibiotics
panp01200  Carbon metabolism
Module
panp_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:panp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PSNIH2_18855
   00020 Citrate cycle (TCA cycle)
    PSNIH2_18855
   00620 Pyruvate metabolism
    PSNIH2_18855
Enzymes [BR:panp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.49  phosphoenolpyruvate carboxykinase (ATP)
     PSNIH2_18855
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPCK_ATP AAA_33
Motif
Other DBs
NCBI-ProteinID: AIX75614
Position
complement(4099698..4101317)
Genome map
AA seq 539 aa AA seqDB search
MRANGLTPQDLVAYGITDTVEVIHNPDYETLFKEETLPGLSGYERGTLTQSGAIAVDTGI
FTGRSPKDKYIVRDDTTRDTLWWNDQGKGKNDNQPLSQETWEALKGCVTQQLSGKRLFVI
DAWCGANPDTRLSVRFITEVAWQAHFVKNMFIRPDAESLASFTPDFVVMNGAKCTNPNWR
EQGLHSENFVAFNLSENMQLIGGTWYGGEMKKGLFAVMNYLLPLKGIASMHCSANVGEQG
DVAVFFGLSGTGKTTLSTDPKRQLIGDDEHGWDDDGVFNFEGGCYAKTINLSEQAEPEIY
HAIRRDALLENVVVRSDGSIDFNDGSKTENTRVSYPIYHIDNIVKPVSKAGHAKKVIFLT
ADAFGVLPPVSRLSSDQTQYHFLSGFTAKLAGTERGVTAPTPTFSACFGAAFLTLHPTKY
AEVLVKRMQAAGAEAWLVNTGWNGTGKRISLKDTRAIINAILSGELDGAETHTLPIFNLQ
FPLAVPGVDSHILDPRNTWEDPSQWESRALDLAHRFIANFEKYTDTPAGAALVSAGPHI
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgctaatggcctgactccccaggacctcgtcgcttatggcatcactgatacggtt
gaagtcatccataatcccgattatgaaactttatttaaggaagaaaccctgcccggactg
tcaggctatgagcgtggcacgttgacgcaatccggggcgatcgccgtggataccggtatc
ttcaccggccgttcgccaaaagataaatatatcgtgcgcgacgataccacacgcgacacc
ctgtggtggaacgatcagggcaaaggcaaaaacgataatcagcccctgtcgcaggaaacc
tgggaagcgctaaagggctgcgtgacgcagcagctctccggcaagcgcctgtttgtgatt
gacgcctggtgcggcgccaaccccgatacgcgcctgagcgtgcgctttattaccgaagtg
gcctggcaggcgcatttcgtcaaaaatatgtttattcgcccggatgcggagagcctcgcc
agcttcacgcccgattttgtggtgatgaacggcgcaaaatgcaccaatcccaactggcgg
gagcagggactgcattcagagaatttcgtcgcctttaatctcagcgagaatatgcagctg
atcggcggcacctggtacggcggcgaaatgaaaaaagggctgttcgcagtgatgaactac
ctgctgccgctgaaaggcatcgcctcgatgcactgctcggccaacgttggcgagcaaggc
gacgtggcggtctttttcggcctctccggcaccggtaaaacgaccctttctaccgatccg
aaacgccagctgatcggcgatgacgaacatggctgggacgatgacggcgtgttcaacttc
gaaggcggctgctacgcgaaaaccattaatctgtcagagcaggcggagccggagatctat
cacgccatccgccgcgacgcgctgctggaaaacgtggtggtgcgcagcgacggcagcatc
gattttaacgacggcagcaaaacggaaaacacccgcgtctcttacccgatctatcatatc
gataatatcgttaagccggtttccaaagcgggacatgcgaagaaagtgattttcctgacc
gccgatgcgttcggcgtgctgccgccggtatcccgtctctcttccgatcagacgcagtat
cacttcctttccggttttaccgctaagctggcgggcaccgagcgcggcgtcaccgcgccg
acgcctaccttctccgcctgcttcggcgccgcgttcctgacgctgcatccgacaaagtat
gcggaagtgctggtgaaacggatgcaggcggcgggcgcggaagcctggctggtgaatacc
ggctggaacggcaccggcaaacgcatttcgctgaaggacacgcgcgctatcatcaacgca
atcctgagcggcgagttggacggggcggaaacgcacaccctgccaatatttaacctgcag
ttcccgttagcggtgccgggcgtcgacagccacattctcgatccgcgcaacacatgggaa
gatccttctcaatgggaaagccgcgcgctcgatctggcgcatcgctttatcgctaacttt
gaaaagtataccgatacgcctgcgggcgccgcgctggtttccgccggcccgcacatttaa

DBGET integrated database retrieval system