KEGG   Pseudomonas antarctica: A7J50_0811Help
Entry
A7J50_0811        CDS       T04830                                 

Definition
(GenBank) alkaline phosphatase
  KO
K01113  alkaline phosphatase D [EC:3.1.3.1]
Organism
panr  Pseudomonas antarctica
Pathway
panr00790  Folate biosynthesis
panr01100  Metabolic pathways
panr02020  Two-component system
Module
panr_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:panr00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    A7J50_0811
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    A7J50_0811
Enzymes [BR:panr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     A7J50_0811
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PhoD PhoD_N
Motif
Other DBs
NCBI-ProteinID: ANF84253
UniProt: A0A172YVE6
Position
961431..962972
Genome map
AA seq 513 aa AA seqDB search
MSHFDLGRRRVMQAVGAGLLLPGLAPAVIASVKDRPQLTDGVQSGDLMGDRAMIWSRSDR
PAKMVVEWDTRSVFSNPRKFISPLADNRTDFTARVELTGLPVDQAIFYRVHFEDAQTGVA
SEPWFGHLRSVPQQRRDIRFVWSGDTVGQGFGINPDIGGMRIYEAMRLRLPDFFIHSGDT
IYADGPVPAQLTVEDGRIWRNITTEAKSKVAETLDEYRGNYRYNLLDENVRRFNAEVPQI
WQWDDHEVVNNWSPSKQLDERYQTKDINTLVGRARQAWLEYSPMRRQSADGGGRIYRKLS
YGPLLDVFVLDMRSYRGPNDDNLGGEKPFMGREQLDWLKRELKASRAQWKVIAADMPIGL
GVPDGEVSPGVPRWEAIANGDPGPAQGRELEIAELLGFLRAQQVRNHVWLTADVHYCAAH
HYHPDRAAFQDFEPFWEFVAGPLNAGSFGPNPLDKTFGPEVVFEKAPPAQNTSPFAGFQF
FGEVQIDGQTAELTVILRDLDGVSVFEQKLQPV
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgagccacttcgatctcggccgtcgccgtgtgatgcaagccgttggcgccggtctgttg
ctgccgggcctggccccggcggtgatcgcctcggtcaaagaccggccgcaactcaccgat
ggtgtgcagtccggcgacctgatgggcgaccgcgcgatgatctggagccgcagcgaccgc
cccgcgaagatggtggtggagtgggacacccgcagtgtgttcagcaacccgcgtaaattc
atctcgccgctggccgacaaccgcaccgacttcaccgcccgcgtcgaactcaccgggctg
ccggtcgatcaggcgattttctatcgcgtgcactttgaggacgcccagaccggcgtcgcc
agcgagccgtggttcggtcacttgcgcagcgtgccgcaacagcgccgcgacattcgtttc
gtgtggagcggcgataccgtcggccagggctttggcatcaacccggacatcggcggcatg
cgcatctacgaagccatgcgcctgcgcctgccggacttctttattcacagcggcgacacc
atctacgccgatggcccggtgccggcgcagctgaccgttgaagacggccgcatctggcgc
aatatcaccaccgaggccaagagcaaagtcgcggaaaccctcgatgaatatcgcggcaac
taccgctacaacctgctcgacgaaaacgtgcgccgcttcaatgccgaggtgccgcagatc
tggcagtgggacgatcacgaggtagtcaacaactggtcgccgagcaagcagttggatgag
cgttaccagaccaaggacatcaacaccctggtcggccgcgcgcgccaggcctggctggag
tattcaccgatgcgccggcaaagcgccgacggtggcgggcggatctatcgcaagctcagc
tacggccccttgctggatgtgttcgtgctggacatgcgcagctatcgcggccccaacgat
gacaacctgggcggcgaaaaacccttcatgggccgcgagcaactggactggctcaagcgc
gagctcaaggcttcccgggcgcagtggaaagtcatcgccgccgacatgcccatcgggctg
ggcgtgcctgatggcgaggtcagccccggcgtgccgcgctgggaggcgatcgccaacggc
gaccctggcccggcccaaggtcgcgagctggagattgccgagctgttgggctttctgcgc
gctcagcaggtgcgtaaccatgtatggctgacggcggatgtgcactactgcgcggcgcat
cactaccaccctgatcgtgcggcgttccaggatttcgagccgttctgggagtttgtggca
gggccgttgaatgcggggagtttcgggccgaacccattggataaaacctttggcccggag
gtggtgttcgagaaggcgccacccgcgcaaaacacttcgccgtttgccgggtttcagttt
tttggtgaggtgcagattgatgggcagacggcggagttgaccgtcattttgcgggatttg
gatggggtgtcagtgttcgagcaaaagctgcaaccggtctga

DBGET integrated database retrieval system