KEGG   Pseudomonas antarctica: A7J50_0945Help
Entry
A7J50_0945        CDS       T04830                                 

Definition
(GenBank) UDP-N-acetylmuramoylalanine--D-glutamate ligase
  KO
K01925  UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC:6.3.2.9]
Organism
panr  Pseudomonas antarctica
Pathway
panr00471  D-Glutamine and D-glutamate metabolism
panr00550  Peptidoglycan biosynthesis
panr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:panr00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    A7J50_0945
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    A7J50_0945
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:panr01011]
    A7J50_0945
Enzymes [BR:panr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.9  UDP-N-acetylmuramoyl-L-alanine---D-glutamate ligase
     A7J50_0945
Peptidoglycan biosynthesis and degradation proteins [BR:panr01011]
 Precursor biosynthesis
  Amino acid ligase
   A7J50_0945
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase_C
Motif
Other DBs
NCBI-ProteinID: ANF84386
UniProt: A0A172YWM8
Position
1102100..1103446
Genome map
AA seq 448 aa AA seqDB search
MSLIASDHFRIVVGLGKSGMSLVRFLANRGTSFAVADTRENPPELVTLRRDYPHVEVRCG
ELDVEFLCRADELYVSPGLALSTPALQAAAARGVKLSGDIDLFARNAKAPIVAISGSNAK
STVTTLVGEMAVAAGKRVAVGGNLGTPALDLLSDDVELYVMELSSFQLETTHDLGAEVAT
VLNVSEDHMDRYSGLPAYHLAKHRIFRGARQVVVNRQDALSRPLMGEGLPCWTFGLGKPD
FKAFGIREENGEKYLAFEFQNLMPVRELKIRGAHNQSNALAALALGHAVGLPFDAMLSSL
RTFAGLEHRCQWVRDLNGVSYYNDSKATNVGAALAAIEGLGADIEGKLVLIAGGDGKGAD
FKDLKGPVAAHCRAVVLMGRDADLIAAALGDAVPQVRATSLDDAIAQCKAMAQPGDAVLL
SPACASFDMFKNYEERGQLFARGVEALA
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
gtgtccctgatcgcttcagaccacttccgcatcgttgtcggcctcggcaagagcggcatg
tccctggttcgcttcctcgcgaaccggggcacgtcgtttgccgtggccgacacgcgggaa
aatccaccggagctggtcacgctgcgccgtgactacccgcacgtggaagtgcgttgtggc
gagttggatgtcgagtttctgtgccgcgccgatgagctctacgtgagccccggcctggct
ctttcgacaccggccctgcaagcggcagcggcgcgtggtgtgaagctgtccggcgacatc
gacctgttcgcacgtaacgccaaggcgccgatcgtggccatcagcggctccaacgcaaaa
agcaccgtgacgaccctggtcggcgagatggcggttgcggccggcaagcgcgtggctgtg
ggcggcaacctcggcacgccggcgctggacctgctcagcgacgacgtcgagctgtacgtg
atggagctgtcgagcttccagctggaaaccacgcacgacctgggtgccgaagtggccacc
gtgctgaacgtcagcgaagaccacatggaccgttacagcggcctgccggcgtatcacctg
gccaagcaccggatcttccgcggtgcccggcaagtggtggtcaaccgccaggatgccctg
agccgtccgctgatgggcgagggcctgccatgctggaccttcggcctgggtaaacctgat
ttcaaagctttcggcattcgcgaagagaacggcgaaaagtacctggccttcgaattccag
aacctgatgccggtgcgcgaactgaaaatccgtggcgcacataaccagtccaatgccctg
gcggccctggcgctgggccatgctgtgggcctgccgtttgatgccatgttgtccagcctg
cgcacattcgccggccttgagcaccgctgccagtgggtgcgcgatctcaatggcgtcagc
tattacaacgattccaaggccaccaacgtcggtgctgccctggcggccatcgaaggcctc
ggtgctgacatcgaaggcaagctggtgctgatcgccggtggcgatggcaagggtgccgac
ttcaaggaccttaaagggccggtggctgcgcattgtcgcgccgtggtgctgatggggcgt
gatgccgacctgatcgccgccgccctgggtgacgctgtgccgcaagtgcgcgccacgtcc
ctggacgacgccattgcccagtgcaaagccatggctcagccgggtgatgccgtgctgctg
tcgccggcgtgcgccagcttcgacatgttcaagaactacgaagagcgcggccagctgttc
gcccgcggcgtggaggccttggcatga

DBGET integrated database retrieval system