KEGG   Pseudomonas antarctica: A7J50_2153Help
Entry
A7J50_2153        CDS       T04830                                 

Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
panr  Pseudomonas antarctica
Pathway
panr00071  Fatty acid degradation
panr00072  Synthesis and degradation of ketone bodies
panr00280  Valine, leucine and isoleucine degradation
panr00310  Lysine degradation
panr00362  Benzoate degradation
panr00380  Tryptophan metabolism
panr00620  Pyruvate metabolism
panr00630  Glyoxylate and dicarboxylate metabolism
panr00640  Propanoate metabolism
panr00650  Butanoate metabolism
panr00900  Terpenoid backbone biosynthesis
panr01100  Metabolic pathways
panr01110  Biosynthesis of secondary metabolites
panr01120  Microbial metabolism in diverse environments
panr01130  Biosynthesis of antibiotics
panr01200  Carbon metabolism
panr01212  Fatty acid metabolism
panr02020  Two-component system
Brite
KEGG Orthology (KO) [BR:panr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    A7J50_2153
   00630 Glyoxylate and dicarboxylate metabolism
    A7J50_2153
   00640 Propanoate metabolism
    A7J50_2153
   00650 Butanoate metabolism
    A7J50_2153
  09103 Lipid metabolism
   00071 Fatty acid degradation
    A7J50_2153
   00072 Synthesis and degradation of ketone bodies
    A7J50_2153
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    A7J50_2153
   00310 Lysine degradation
    A7J50_2153
   00380 Tryptophan metabolism
    A7J50_2153
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    A7J50_2153
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    A7J50_2153
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    A7J50_2153
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:panr04147]
    A7J50_2153
Enzymes [BR:panr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     A7J50_2153
Exosome [BR:panr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   A7J50_2153
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ANF85566
UniProt: A0A172Z027
Position
complement(2332876..2334057)
Genome map
AA seq 393 aa AA seqDB search
MQDVVIVAATRTAVGSFQGSLASIPAPELGAAVIRRLLEQTGLDPAQVDEVILGQVLTAG
SGQNPARQASILAGLPHAVPALTLNKVCGSGLKALHLGAQAIRCGDADVIIAGGMENMSL
APYVLPAARTGLRMGHAKMIDSMITDGLWDAFNDYHMGITAENLVDKYGISREAQDAFAA
ASQQKATAAIEAGRFVDEITPILIPQRKGDPVAFAVDEQPRAGTTAESLAKLKPAFKKDG
SVTAGNASSLNDGAAAVLLMSADKAKALGLPVLARIASYANAGVDPAIMGIGPVSATRRC
LGKAGWSLGDLDLIEANEAFAAQSLAVGKELEWDADKVNVNGGAIAIGHPIGASGCRVLV
TLLHEMIKRDAKKGLATLCIGGGQGVALALERS
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgcaagacgtcgtgattgttgctgccacccgcaccgccgtgggcagctttcaaggttcg
ctggccagtatcccggcgccggaactgggcgcggccgtgatccgtcgcctgctggagcag
accggcctggaccccgctcaggtagatgaagtcatcctcggccaggtgctcacggccggc
agcggccagaaccccgcgcgccaggcgtcgatcctcgccggcctgccccatgccgtgccg
gccttgaccctgaacaaggtgtgcggttctggcctcaaggcgctgcacttgggcgcccag
gcgattcgttgcggcgacgctgacgtgatcatcgccggcggtatggaaaacatgagcctg
gcgccgtacgtgttgcccgctgcgcgcaccggcttgcgcatgggccacgccaagatgatc
gacagtatgatcaccgacggcttgtgggatgcgttcaacgactaccacatgggcatcacc
gccgagaacctggtggacaaatacggcatcagccgtgaagcccaggacgccttcgccgct
gcctcccagcagaaagccactgcggcgatcgaagccggccggtttgtcgatgagatcacg
cccatcctgatcccccagcgcaaaggcgacccggtggccttcgcggtcgatgaacagccg
cgcgccggcaccaccgccgaatccctggccaagctcaagcccgcgttcaaaaaggacggc
agcgtcaccgctggcaacgcctccagcctcaatgacggcgcggcggcggtactgctgatg
agcgctgataaagccaaggcgctcggcctgcccgttctggcgcgtattgccagctacgcc
aacgccggtgttgaccccgccatcatgggcatcggcccggtctcggccacgcgccgctgc
ctgggcaaagccggctggagcctgggcgacctggacctgatcgaagctaacgaagccttc
gccgcgcaatccctggcggtgggcaaagagctggagtgggatgcggacaaggtcaacgtc
aacggtggcgctattgccatcggccacccgatcggcgcctcaggctgccgtgtgctggtg
accctgctgcatgaaatgatcaagcgcgatgccaagaaaggcctcgcgacgctgtgcatc
ggtggcggtcaaggcgtagccctcgccctcgaacgcagctga

DBGET integrated database retrieval system