KEGG   Pseudomonas antarctica: A7J50_2722Help
Entry
A7J50_2722        CDS       T04830                                 

Definition
(GenBank) Putative gamma-glutamyltranspeptidase
  KO
K00681  gamma-glutamyltranspeptidase / glutathione hydrolase [EC:2.3.2.2 3.4.19.13]
Organism
panr  Pseudomonas antarctica
Pathway
panr00430  Taurine and hypotaurine metabolism
panr00460  Cyanoamino acid metabolism
panr00480  Glutathione metabolism
panr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:panr00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    A7J50_2722
   00460 Cyanoamino acid metabolism
    A7J50_2722
   00480 Glutathione metabolism
    A7J50_2722
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:panr01002]
    A7J50_2722
Enzymes [BR:panr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.2  gamma-glutamyltransferase
     A7J50_2722
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.13  glutathione gamma-glutamate hydrolase
     A7J50_2722
Peptidases and inhibitors [BR:panr01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   A7J50_2722
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G_glu_transpept MotA_ExbB Sporozoite_P67
Motif
Other DBs
NCBI-ProteinID: ANF86120
UniProt: A0A172Z116
Position
2995009..2996733
Genome map
AA seq 574 aa AA seqDB search
MKYQPFSRTLIATALVLTVSGVQAASQAPVAGENGMVVTAQHLATHVGVDVLKAGGNAVD
AAVAVGYALAVVYPAAGNLGGGGFMTVQLADGRKTFLDFREKAPLAATADMYLDKDGKVI
DGLSAKGHLAVGVPGTVSGMETALSQYGTLKRAQVIAPAIKLAENGFELEQGDIDLLHTA
TGEFEKDQDLRAIFLHNGQPMQVGQKLVQKDLAKTLKEISAKGADGFYKGWVAKALVDSS
QAGKGIITQADLDKYKTRELAPIECDYRGYHVVSAPPPSSGGVVICQIMNILEGYPMADL
GYHSAQGLHYQIEAMRHAYVDRNSYLGDPDFVKNPVAHLLDKDYAAKLRAAIEPQKAGDS
QAIKPGVSPHEGNNTTHYSIVDKWGNAVSVTYTLNDWFGAGVMASKTGVILNDEMDDFTV
KVGVPNMYGLVQGEANAIAPGKAPLSSMSPTIVTKDGKAVMVVGTPGGSRIITATLLTIL
NVIDYKMNIQEAVDAPRFHQQWMPETTNLEAFAVSPDTQKILESWGHKFAGPQDANHLAA
ILVGAPSLGGKPVGNNRFYGANDPRRNTGLSLGY
NT seq 1725 nt NT seq  +upstreamnt  +downstreamnt
atgaaataccaacccttcagccgtaccctgattgccaccgcactggtgttgaccgtcagc
ggtgtgcaagccgcttcccaggccccggtggccggtgaaaatggcatggtggtcacggcc
cagcatttggcaactcacgtgggcgtcgatgtgctcaaggccggcggcaacgcggtcgat
gcggctgtggccgtgggctacgccctggccgtggtctacccggcggcgggcaacctgggc
ggcggcggcttcatgaccgtgcaactggcggatgggcgcaagactttcctcgacttccgc
gaaaaagccccgctggcggcgacggccgacatgtacctggacaaagacggcaaggtcatc
gacggccttagcgccaagggccatttggcggtcggcgtacccggcacggtgtccgggatg
gaaacggcgctgagccaatacggcaccctcaagcgcgcccaggtgattgccccggcgatc
aagctggcggaaaacggtttcgaactggagcagggtgatatcgacctgctgcacaccgcc
accggcgagttcgaaaaagaccaggacctgcgcgcaatcttcctgcacaacggccagccg
atgcaggtcggccagaagctggtgcagaaagacctggccaagaccctcaaggaaatctcc
gccaagggcgccgacggtttctataaaggctgggtcgccaaggcgctggtggattccagc
caggccggcaaaggcatcatcacccaggctgacctcgacaagtacaagacccgtgaactg
gcgcccatcgagtgcgactaccgaggctaccacgtggtctcggcaccgccgccgagctcg
ggtggcgtggtgatctgccagatcatgaacatccttgaaggctacccgatggccgacctc
ggctatcactcggcccaaggcctgcactaccagatcgaagcgatgcgccacgcctacgtg
gaccgtaacagctacctgggcgacccggacttcgtgaagaacccggtcgctcatttgctg
gacaaggactacgccgccaagctgcgcgcagccatcgagccgcagaaagccggggattcc
caggcgatcaagccgggtgtgtcgccccatgaaggcaacaacaccacgcattactccatc
gtcgacaagtggggcaacgccgtatcggtgacctacaccctgaacgactggtttggtgcc
ggcgtcatggcgagcaagaccggggtgatcctcaacgatgaaatggatgacttcaccgtc
aaggtcggcgtaccgaacatgtacgggctggtccagggtgaggccaatgccatcgctccg
ggcaaggcgcctttgtcgtcgatgagcccgaccatcgtgaccaaagacggcaaggccgtg
atggtggtgggtacgccaggaggcagccggattatcacggcgaccttgctgaccatcctg
aatgtcatcgactacaagatgaacatccaggaggccgtcgacgccccgcgtttccaccag
cagtggatgcctgagaccaccaacctcgaggccttcgccgtcagcccggacacccagaag
atcctggaaagctggggccacaagtttgccggtccacaggacgccaaccacttggccgcg
atcctggtgggcgcaccgtcactgggtggcaagccggtaggcaacaaccgtttctacggg
gctaacgacccgcgtcgcaacaccggcctgtctttgggctactaa

DBGET integrated database retrieval system