KEGG   Pseudomonas antarctica: A7J50_2728Help
Entry
A7J50_2728        CDS       T04830                                 

Definition
(GenBank) Putative amidase
  KO
K01426  amidase [EC:3.5.1.4]
Organism
panr  Pseudomonas antarctica
Pathway
panr00330  Arginine and proline metabolism
panr00360  Phenylalanine metabolism
panr00380  Tryptophan metabolism
panr00627  Aminobenzoate degradation
panr00643  Styrene degradation
panr01100  Metabolic pathways
panr01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:panr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    A7J50_2728
   00360 Phenylalanine metabolism
    A7J50_2728
   00380 Tryptophan metabolism
    A7J50_2728
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    A7J50_2728
   00643 Styrene degradation
    A7J50_2728
Enzymes [BR:panr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.4  amidase
     A7J50_2728
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: ANF86126
UniProt: A0A172Z1Q2
Position
3001146..3002432
Genome map
AA seq 428 aa AA seqDB search
MSLSDSLLRHSATKLGALIQQRKLSSTAIVSAYLARIEALNPSVNALVQVCAEAALASAW
AADHAVANGEYWGALHGVPFTVKDVIDTRGVVSAVGLTERAHYLPEQDAVVVTRMKAAGG
ILLGKSNCPPGGGGGVTHNPVYGATRNPHALAYSPGGSSGGEAAAIAAGLSPLGLGSDSG
GSLRVPAHFCGVCTLKPTSGRVPNTGVFDHPGGLSDYRSQIGPMARHVEDLALVLQVIAG
EDGRDAGVIPMPLRGMQTQTLKGLRVAWYSDGGIESVDAITQETLQVVAALLERAGALIR
PAFPSALSNARDITERYWAMSKGTGAQSIQLLSDWDQFRTAMLGFMADYDLILCPVDAAP
ATRLGETRPGLFSHTLPYSLAGWPCVVVRGGTDHAGLPVGVQIVARPWHEHLALAAAAAI
ERALPFPL
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgtctttatcggattcattgctacgccattctgctaccaaacttggcgcattgattcaa
cagcgcaagctctcatctaccgccattgtctccgcctacctcgcacgtatcgaggcgctc
aacccttcggttaacgccttggttcaagtgtgtgccgaggcggcgctggccagtgcgtgg
gcggcggatcatgcagtcgccaacggtgagtattggggcgcgttacacggcgttcccttt
acggtcaaagatgttatcgacacgcgcggcgtggtgtcggcggtgggtttgactgagcgg
gctcactacctgccggaacaggacgccgtggtggtgacgcgcatgaaagccgccggcggc
attttgcttggcaaaagcaactgcccgccgggtggcggcggcggtgtcacccacaatcct
gtctacggcgccacgcgcaacccgcatgcgcttgcctatagccccggaggcagcagtggt
ggcgaagcggcggcgattgctgctgggctttcaccgttggggctgggcagcgactccggt
ggcagcttgcgcgtccccgcacatttttgtggtgtctgtacgttgaaacccaccagcggc
cgtgtgcctaacaccggtgtctttgatcacccgggcgggttgagtgactatcgcagtcag
attggcccgatggcccggcatgtcgaagacctggccctggtgctgcaggtcattgccggt
gaagatgggcgcgatgccggggtgattccgatgccgttgcgcggtatgcagactcaaacg
ctgaagggtttgcgagtcgcctggtacagcgatggcggcattgagtccgtcgacgcaatc
acgcaagagacactgcaggtagtggccgctctgttggaacgtgcaggcgccttgatccgt
ccggcctttccatcggcgttgagcaatgcccgcgacattaccgaacgctactgggcaatg
agtaaaggcaccggcgcgcagtcgatacagttgctttcagattgggatcagtttcgcacg
gccatgctggggttcatggccgactacgaccttatcctgtgccctgtcgacgcggcgccg
gcaacccgcctgggagagactcggccagggctgttcagtcacacgttgccttacagcctg
gcgggttggccttgtgtggtggtgcgcggcggaactgatcacgccggtttgccggttggc
gtgcagattgtcgcgcgaccctggcacgagcatctcgcgttggcggcggcagcggccatt
gagcgcgcgctgccgttcccgctttga

DBGET integrated database retrieval system