KEGG   Pseudomonas antarctica: A7J50_2964Help
Entry
A7J50_2964        CDS       T04830                                 

Definition
(GenBank) bifunctional UDP-glucuronic acid decarboxylase/UDP-4-amino-4-deoxy-L-arabinose formyltransferase
  KO
K10011  UDP-4-amino-4-deoxy-L-arabinose formyltransferase / UDP-glucuronic acid dehydrogenase (UDP-4-keto-hexauronic acid decarboxylating) [EC:2.1.2.13 1.1.1.305]
Organism
panr  Pseudomonas antarctica
Pathway
panr00520  Amino sugar and nucleotide sugar metabolism
panr01100  Metabolic pathways
panr01503  Cationic antimicrobial peptide (CAMP) resistance
Brite
KEGG Orthology (KO) [BR:panr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    A7J50_2964
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    A7J50_2964
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:panr01005]
    A7J50_2964
Enzymes [BR:panr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.305  UDP-glucuronic acid dehydrogenase (UDP-4-keto-hexauronic acid decarboxylating)
     A7J50_2964
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.13  UDP-4-amino-4-deoxy-L-arabinose formyltransferase
     A7J50_2964
Lipopolysaccharide biosynthesis proteins [BR:panr01005]
 Unusual sugar
  A7J50_2964
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase Formyl_trans_N GDP_Man_Dehyd Formyl_trans_C 3Beta_HSD NAD_binding_10 TrkA_N NAD_binding_4 RmlD_sub_bind
Motif
Other DBs
NCBI-ProteinID: ANF86352
UniProt: A0A172Z1Y6
Position
3275522..3277513
Genome map
AA seq 663 aa AA seqDB search
MNSKAVVFAYHDIGCAGIEALLTAGYDIAAVFTHADDPKENNFYGSVAQLCARNGIPVHA
PEDANHPLWIERIAKLNPDFIFSFYYRNLLSEALLATAKKGAFNLHGSLLPKYRGRAPAN
WVLVNGETETGVTLHRMVKRADAGAILAQQKVVIDRTDTGLTLHAKLREAATNLLRDALP
QLAQGKLAETAQNESQATYFGRRTAADGKLDWKKPAEELFNLVRAVTQPYPGAFCAVGEH
KLIVWQADVVKGNEGIAPGRVISVNPLRIACGEDSLVVKFGQRNENGLYLAGPSLADELG
LVDGSVLRGAESGRKPRRTRVLILGVNGFIGNHLSERLLRDDRYEIYGLDIGSDAIERLR
SHPNFHYVEGDISIHSEWIEYHIKKCDVVLPLVAIATPIEYTRNPLRVFELDFEENLKLV
RYCVKYNKRVIFPSTSEVYGMCQDQYFDEDTSNLVVGPVNKQRWIYSVSKQLLDRVIWAY
GDKGLNFTLFRPFNWMGPRLDRLDSARIGSSRAITQLILNLVEGTPIRLFDGGEQKRCFT
DIADGIEALARIIDNDNDVCNGQIINIGNPENEASIRQLGEELLRQFEAHPLRSNFPPFA
GFRDVESKAFYGTGYQDVAHRKPSIENAKRLLNWEPTVEMSETIGNTLDFFLKEAMLEIA
DKR
NT seq 1992 nt NT seq  +upstreamnt  +downstreamnt
atgaattcaaaagctgttgtcttcgcttatcacgatattggctgtgcaggcattgaagcc
ctgctgaccgccggctacgacattgctgccgtgttcacccatgccgacgaccccaaggaa
aataatttctacggctccgtcgcccaactctgtgcccgcaacggcatcccggtacacgca
ccggaagacgccaaccacccactgtggatcgagcgcattgccaagctgaacccggatttc
atcttctcgttctactaccgcaacctgctgagcgaagccctgctggccaccgccaaaaaa
ggtgcgttcaacctgcacggctcgctgctgcctaagtaccgtggccgcgccccggccaac
tgggtgctggtaaacggcgaaaccgaaaccggcgtgaccctgcaccgcatggtcaagcgt
gccgacgctggcgcgatcctggcccagcaaaaagtcgttatcgaccgcactgacactggc
ctgaccctgcacgccaaactgcgtgaagcggccaccaacctgctgcgtgatgccctgcca
caactggcccaaggcaagctggcggaaactgcccagaacgaaagccaggcgacctacttc
ggccgccgcaccgctgccgatggcaaactggactggaaaaagccggctgaagagctgttc
aacctggttcgcgccgtcacccaaccttacccgggcgccttctgcgccgtaggcgagcac
aaactgatcgtttggcaagccgatgtggtcaagggcaacgaaggcattgccccgggccgt
gtgatcagcgtcaacccgctgcgcatcgcctgcggtgaagattccctggtggtcaagttt
ggccagcgcaacgaaaacggcctgtacctggccggtccttccctggccgacgagttgggc
ctggtggacggttccgtactgcgcggcgccgagtccggccgcaagccacgtcgtactcgc
gtactgatcctgggtgtgaacggtttcatcggtaaccacctgtcagagcgcctgctgcgt
gacgaccgttacgaaatctacggcctggatatcggttccgacgctatcgagcgcctgcgc
agccacccgaacttccactacgtggaaggcgacatcagcattcactccgagtggatcgag
taccacatcaagaagtgcgacgtggtcctgccgctggtggccatcgctacccctatcgaa
tacacccgtaacccactgcgcgtgttcgaactggactttgaagagaacctgaaactggtt
cgctactgcgtcaagtacaacaagcgtgtgatcttcccgtcgacctccgaagtctatggc
atgtgccaggaccagtacttcgacgaagacacctccaacctggtggttggcccggtcaac
aagcaacgctggatctactcggtctccaagcaactgctggaccgtgtgatctgggcttac
ggcgacaaaggcctgaacttcaccctgttccgtccgttcaactggatgggcccgcgcctg
gaccgtctggactcggcacgtatcggcagctcccgtgcaatcacccagttgatcctgaac
ctggtagaaggcacgccgatccgcctgttcgacggtggcgagcagaagcgttgcttcacc
gacatcgctgacggcatcgaagccctggcacgcatcattgataacgacaacgatgtctgc
aatggccagatcatcaacatcggcaacccggaaaacgaagccagcattcgtcagctgggc
gaagagctgctgcgtcagttcgaagctcacccgctgcgtagcaacttccctccgttcgcc
ggtttccgcgacgtagagagcaaggcgttctacggcaccggttaccaggacgtggcgcac
cgcaagccaagcatcgaaaacgccaagcgcctgctgaactgggagccaaccgttgagatg
agcgaaaccatcggtaacaccctggacttcttccttaaagaagccatgctcgaaatcgcg
gacaagcgctga

DBGET integrated database retrieval system